BLASTX nr result
ID: Scutellaria24_contig00008954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00008954 (375 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510056.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 >ref|XP_002510056.1| conserved hypothetical protein [Ricinus communis] gi|223550757|gb|EEF52243.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 56.6 bits (135), Expect = 2e-06 Identities = 42/132 (31%), Positives = 65/132 (49%), Gaps = 27/132 (20%) Frame = +2 Query: 47 RKVKWRSVEETNKQLSPISVLEENESDQ-----------------------EDSPLHHNQ 157 RK++W+ +EE+ +QLSP+SVLEE S EDS L + Sbjct: 152 RKLRWQCIEES-RQLSPVSVLEEAASHSASQLHKYKVKDSKSSFLFPKKVTEDSILSASL 210 Query: 158 EKMKSRQEDSCSTYNNVEDHLQELVDSK---MYCQYM-INKRALQERKQLLIDCVREVIE 325 K+ + E+ +QELV S +Y+ N ALQ+ +QLL DCVRE+++ Sbjct: 211 RKVLFQSENQKKPTLAGVSEIQELVQSNNNNASSRYLKSNSSALQQTRQLLFDCVREIVD 270 Query: 326 SHRRKDNKNGEQ 361 + RK+ + +Q Sbjct: 271 NQERKEKPHQQQ 282