BLASTX nr result
ID: Scutellaria24_contig00008542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00008542 (360 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN63149.1| hypothetical protein VITISV_040802 [Vitis vinifera] 60 1e-07 ref|XP_002277620.1| PREDICTED: uncharacterized protein LOC100253... 59 3e-07 ref|XP_002297842.1| predicted protein [Populus trichocarpa] gi|1... 59 4e-07 ref|XP_002514909.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 emb|CBI27661.3| unnamed protein product [Vitis vinifera] 57 2e-06 >emb|CAN63149.1| hypothetical protein VITISV_040802 [Vitis vinifera] Length = 272 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 5/41 (12%) Frame = -2 Query: 359 KMYAEAFLCNKYRVHAVGRLWHFEIPPAANL-----NSGFC 252 K+YAE FLC KY V +VGRLWHFEIPPAANL ++GFC Sbjct: 232 KVYAEEFLCRKYLVGSVGRLWHFEIPPAANLSRASDSTGFC 272 >ref|XP_002277620.1| PREDICTED: uncharacterized protein LOC100253955 [Vitis vinifera] Length = 282 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/41 (65%), Positives = 32/41 (78%), Gaps = 5/41 (12%) Frame = -2 Query: 359 KMYAEAFLCNKYRVHAVGRLWHFEIPPAANL-----NSGFC 252 K+YAE LC KY+V +VGRLWHFEIPPAANL ++GFC Sbjct: 242 KVYAEELLCRKYQVGSVGRLWHFEIPPAANLSRASDSTGFC 282 >ref|XP_002297842.1| predicted protein [Populus trichocarpa] gi|118483182|gb|ABK93495.1| unknown [Populus trichocarpa] gi|222845100|gb|EEE82647.1| predicted protein [Populus trichocarpa] Length = 285 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 3/39 (7%) Frame = -2 Query: 359 KMYAEAFLCNKYRVHAVGRLWHFEIPPAANLNSG---FC 252 KM+AE FLC KY V AVGRLWHFEIPPAAN++ FC Sbjct: 247 KMFAEEFLCRKYLVKAVGRLWHFEIPPAANVSQSDGWFC 285 >ref|XP_002514909.1| conserved hypothetical protein [Ricinus communis] gi|223545960|gb|EEF47463.1| conserved hypothetical protein [Ricinus communis] Length = 285 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/39 (66%), Positives = 30/39 (76%), Gaps = 3/39 (7%) Frame = -2 Query: 359 KMYAEAFLCNKYRVHAVGRLWHFEIPPAANLN---SGFC 252 K+YAE FLC KY V AVGRLWHFE+PPAAN++ FC Sbjct: 247 KIYAEEFLCRKYLVKAVGRLWHFELPPAANVSLTGDSFC 285 >emb|CBI27661.3| unnamed protein product [Vitis vinifera] Length = 312 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -2 Query: 359 KMYAEAFLCNKYRVHAVGRLWHFEIPPAANLN 264 K+YAE LC KY+V +VGRLWHFEIPPAANL+ Sbjct: 241 KVYAEELLCRKYQVGSVGRLWHFEIPPAANLS 272