BLASTX nr result
ID: Scutellaria24_contig00008199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00008199 (902 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN81112.1| hypothetical protein VITISV_032626 [Vitis vinifera] 64 5e-08 >emb|CAN81112.1| hypothetical protein VITISV_032626 [Vitis vinifera] Length = 1208 Score = 63.9 bits (154), Expect = 5e-08 Identities = 32/45 (71%), Positives = 35/45 (77%) Frame = +1 Query: 1 CRRLMKNEFGTNNSHLEATRSSRTLHDFAESNYLAHLSFVRTNSK 135 CRR +K EFG S E R+ R+LHDFAESNYLAHLSFVRTNSK Sbjct: 1165 CRRFLKEEFGKPYS--EGVRAHRSLHDFAESNYLAHLSFVRTNSK 1207