BLASTX nr result
ID: Scutellaria24_contig00007634
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00007634 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002270298.2| PREDICTED: uncharacterized protein LOC100263... 69 3e-10 emb|CBI38997.3| unnamed protein product [Vitis vinifera] 69 3e-10 ref|XP_002284693.2| PREDICTED: uncharacterized protein LOC100247... 68 7e-10 emb|CBI18948.3| unnamed protein product [Vitis vinifera] 68 7e-10 ref|XP_002268852.1| PREDICTED: uncharacterized protein LOC100257... 67 2e-09 >ref|XP_002270298.2| PREDICTED: uncharacterized protein LOC100263216 [Vitis vinifera] Length = 380 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -2 Query: 216 DRCWRVEWPKKDEVNSFKDANKVLKNLGADALRDAIDRAKSYQMQN 79 +RCWRV WPKK++ + FKDAN+VLKNLGADALR+ I+ A+ Y++ + Sbjct: 330 ERCWRVSWPKKEDSSCFKDANEVLKNLGADALREVIENAELYEVNS 375 >emb|CBI38997.3| unnamed protein product [Vitis vinifera] Length = 276 Score = 69.3 bits (168), Expect = 3e-10 Identities = 28/46 (60%), Positives = 39/46 (84%) Frame = -2 Query: 216 DRCWRVEWPKKDEVNSFKDANKVLKNLGADALRDAIDRAKSYQMQN 79 +RCWRV WPKK++ + FKDAN+VLKNLGADALR+ I+ A+ Y++ + Sbjct: 226 ERCWRVSWPKKEDSSCFKDANEVLKNLGADALREVIENAELYEVNS 271 >ref|XP_002284693.2| PREDICTED: uncharacterized protein LOC100247126 [Vitis vinifera] Length = 928 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = -2 Query: 216 DRCWRVEWPKKDEVNSFKDANKVLKNLGADALRDAIDRAKSYQMQNIE*LINFLHLHTSI 37 +RCWRV+WPKK+EV+ FKDAN+VL LG DAL++ I+ A+ Y +Q L NF H I Sbjct: 162 ERCWRVKWPKKNEVDHFKDANEVLMYLGPDALKEVIENAELYPIQG---LFNFSHYFDEI 218 >emb|CBI18948.3| unnamed protein product [Vitis vinifera] Length = 696 Score = 68.2 bits (165), Expect = 7e-10 Identities = 32/60 (53%), Positives = 42/60 (70%) Frame = -2 Query: 216 DRCWRVEWPKKDEVNSFKDANKVLKNLGADALRDAIDRAKSYQMQNIE*LINFLHLHTSI 37 +RCWRV+WPKK+EV+ FKDAN+VL LG DAL++ I+ A+ Y +Q L NF H I Sbjct: 371 ERCWRVKWPKKNEVDHFKDANEVLMYLGPDALKEVIENAELYPIQG---LFNFSHYFDEI 427 >ref|XP_002268852.1| PREDICTED: uncharacterized protein LOC100257655 [Vitis vinifera] gi|297740887|emb|CBI31069.3| unnamed protein product [Vitis vinifera] Length = 705 Score = 66.6 bits (161), Expect = 2e-09 Identities = 31/60 (51%), Positives = 40/60 (66%) Frame = -2 Query: 216 DRCWRVEWPKKDEVNSFKDANKVLKNLGADALRDAIDRAKSYQMQNIE*LINFLHLHTSI 37 +RCWRV+WPKK+EV FKDAN+VL LG D L++ I+ A+ Y +Q L NF H I Sbjct: 372 ERCWRVKWPKKNEVEHFKDANEVLMYLGPDVLKEVIENAEIYPIQG---LFNFSHYFNEI 428