BLASTX nr result
ID: Scutellaria24_contig00007624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00007624 (225 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275749.2| PREDICTED: ferredoxin-3, chloroplastic-like ... 57 1e-06 emb|CAN74125.1| hypothetical protein VITISV_038770 [Vitis vinifera] 55 6e-06 >ref|XP_002275749.2| PREDICTED: ferredoxin-3, chloroplastic-like isoform 1 [Vitis vinifera] Length = 154 Score = 57.4 bits (137), Expect = 1e-06 Identities = 27/47 (57%), Positives = 37/47 (78%) Frame = -3 Query: 145 MATAPLPTNFIIRSAAQNRPSTAFVKSPISLSSGKSVAKAFGLKAKP 5 M+T LPT+ + RSA QNR ++AF++SP SL S KS++KAFGLK+ P Sbjct: 4 MSTVNLPTHCMFRSATQNRIASAFIRSPSSLGSVKSISKAFGLKSSP 50 >emb|CAN74125.1| hypothetical protein VITISV_038770 [Vitis vinifera] Length = 151 Score = 55.1 bits (131), Expect = 6e-06 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -3 Query: 145 MATAPLPTNFIIRSAAQNRPSTAFVKSPISLSSGKSVAKAFGLKAKP 5 M+T LPT+ + RSA QN ++AF++SP SL S KS++KAFGLK+ P Sbjct: 1 MSTVNLPTHCMFRSATQNXIASAFIRSPSSLGSVKSISKAFGLKSSP 47