BLASTX nr result
ID: Scutellaria24_contig00007483
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00007483 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADU60362.1| glutamyl-tRNA reductase binding protein [Nicotian... 65 6e-09 gb|ADU60361.1| glutamyl-tRNA reductase binding protein [Nicotian... 64 1e-08 emb|CBI25290.3| unnamed protein product [Vitis vinifera] 59 3e-07 ref|XP_002274572.1| PREDICTED: uncharacterized protein LOC100260... 59 3e-07 >gb|ADU60362.1| glutamyl-tRNA reductase binding protein [Nicotiana tabacum] Length = 320 Score = 65.1 bits (157), Expect = 6e-09 Identities = 37/69 (53%), Positives = 44/69 (63%) Frame = -1 Query: 208 LPITHFSKPLVSHSGPRNRVFFKPLKTDRFRIPPLKCSVSVVSEPPHLDLSINHKPFPAE 29 LP T SK + S NR F K RF I PL+C+VSVVSEP + + N KP+PAE Sbjct: 10 LPSTRLSKVALPFSKSWNRAQFTFPKCPRFSIGPLRCAVSVVSEPIQSEKTNNGKPYPAE 69 Query: 28 VSRTIVELS 2 VSRTI+ELS Sbjct: 70 VSRTIMELS 78 >gb|ADU60361.1| glutamyl-tRNA reductase binding protein [Nicotiana tabacum] Length = 320 Score = 64.3 bits (155), Expect = 1e-08 Identities = 37/69 (53%), Positives = 45/69 (65%) Frame = -1 Query: 208 LPITHFSKPLVSHSGPRNRVFFKPLKTDRFRIPPLKCSVSVVSEPPHLDLSINHKPFPAE 29 LP T SK + S +R F K+ RF I PLKC+VSVVSEP + + N KP+PAE Sbjct: 10 LPSTRLSKIALPLSKSWSRAQFAFSKSPRFSIGPLKCAVSVVSEPIQSEKTNNGKPYPAE 69 Query: 28 VSRTIVELS 2 VSRTI+ELS Sbjct: 70 VSRTIMELS 78 >emb|CBI25290.3| unnamed protein product [Vitis vinifera] Length = 318 Score = 59.3 bits (142), Expect = 3e-07 Identities = 35/64 (54%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = -1 Query: 184 PLVSHSGPRNRVFFKPLKTDRFR---IPPLKCSVSVVSEPPHLDLSINHKPFPAEVSRTI 14 P + S P F P K FR LKCSVSV SEP HL+L + +KPFPAEVSRTI Sbjct: 14 PSLPLSKPTTITHFSPPKATPFRKSLFQTLKCSVSVASEPAHLEL-VRNKPFPAEVSRTI 72 Query: 13 VELS 2 +ELS Sbjct: 73 MELS 76 >ref|XP_002274572.1| PREDICTED: uncharacterized protein LOC100260424 [Vitis vinifera] Length = 324 Score = 59.3 bits (142), Expect = 3e-07 Identities = 35/64 (54%), Positives = 40/64 (62%), Gaps = 3/64 (4%) Frame = -1 Query: 184 PLVSHSGPRNRVFFKPLKTDRFR---IPPLKCSVSVVSEPPHLDLSINHKPFPAEVSRTI 14 P + S P F P K FR LKCSVSV SEP HL+L + +KPFPAEVSRTI Sbjct: 20 PSLPLSKPTTITHFSPPKATPFRKSLFQTLKCSVSVASEPAHLEL-VRNKPFPAEVSRTI 78 Query: 13 VELS 2 +ELS Sbjct: 79 MELS 82