BLASTX nr result
ID: Scutellaria24_contig00007432
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00007432 (715 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003521441.1| PREDICTED: bystin-like [Glycine max] 59 1e-06 ref|XP_004139649.1| PREDICTED: bystin-like [Cucumis sativus] gi|... 57 4e-06 ref|NP_174447.2| putative bystin [Arabidopsis thaliana] gi|20268... 57 5e-06 gb|AAG60158.1|AC074360_23 bystin, putative [Arabidopsis thaliana] 57 5e-06 ref|XP_003612524.1| Bystin [Medicago truncatula] gi|355513859|gb... 56 6e-06 >ref|XP_003521441.1| PREDICTED: bystin-like [Glycine max] Length = 442 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +3 Query: 624 SYFIKLLVEKKYALPYRVLDALVAHFMRFY 713 SYFIKLL+EKKYALPYRV+DA+VAHFMRF+ Sbjct: 318 SYFIKLLLEKKYALPYRVVDAVVAHFMRFF 347 >ref|XP_004139649.1| PREDICTED: bystin-like [Cucumis sativus] gi|449475424|ref|XP_004154452.1| PREDICTED: bystin-like [Cucumis sativus] Length = 442 Score = 57.0 bits (136), Expect = 4e-06 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +3 Query: 624 SYFIKLLVEKKYALPYRVLDALVAHFMRF 710 SYFIKL++EKKYALPYRV+DA+VAHFMRF Sbjct: 322 SYFIKLILEKKYALPYRVVDAVVAHFMRF 350 >ref|NP_174447.2| putative bystin [Arabidopsis thaliana] gi|20268780|gb|AAM14093.1| putative bystin [Arabidopsis thaliana] gi|28392856|gb|AAO41865.1| putative bystin [Arabidopsis thaliana] gi|332193260|gb|AEE31381.1| putative bystin [Arabidopsis thaliana] Length = 444 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 624 SYFIKLLVEKKYALPYRVLDALVAHFMRF 710 SYFIK+L+EKKY +PYRVLDALVAHFMRF Sbjct: 325 SYFIKVLLEKKYCMPYRVLDALVAHFMRF 353 >gb|AAG60158.1|AC074360_23 bystin, putative [Arabidopsis thaliana] Length = 442 Score = 56.6 bits (135), Expect = 5e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 624 SYFIKLLVEKKYALPYRVLDALVAHFMRF 710 SYFIK+L+EKKY +PYRVLDALVAHFMRF Sbjct: 325 SYFIKVLLEKKYCMPYRVLDALVAHFMRF 353 >ref|XP_003612524.1| Bystin [Medicago truncatula] gi|355513859|gb|AES95482.1| Bystin [Medicago truncatula] Length = 495 Score = 56.2 bits (134), Expect = 6e-06 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +3 Query: 624 SYFIKLLVEKKYALPYRVLDALVAHFMRF 710 SYFIKL +EKKYALPYRV+DA+VAHFMRF Sbjct: 324 SYFIKLFLEKKYALPYRVVDAVVAHFMRF 352