BLASTX nr result
ID: Scutellaria24_contig00007072
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00007072 (212 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521472.1| conserved hypothetical protein [Ricinus comm... 69 4e-10 emb|CBI34859.3| unnamed protein product [Vitis vinifera] 65 4e-09 ref|XP_002273410.1| PREDICTED: altered inheritance of mitochondr... 65 4e-09 gb|AAB33256.1| Clostridium pasteurianum ferredoxin homolog [Sola... 63 3e-08 ref|XP_004168334.1| PREDICTED: altered inheritance of mitochondr... 62 5e-08 >ref|XP_002521472.1| conserved hypothetical protein [Ricinus communis] gi|223539371|gb|EEF40962.1| conserved hypothetical protein [Ricinus communis] Length = 361 Score = 68.9 bits (167), Expect = 4e-10 Identities = 39/85 (45%), Positives = 49/85 (57%), Gaps = 16/85 (18%) Frame = -1 Query: 212 KEAEKVEEPKIANGTVEKQPQ---DISNGKNTESVGGCCQGSNGFSCCRDADV---EEKP 51 +E EKV E K+ NG K+ + + S N E+VGGCCQGSNGFSCCRD ++ EEK Sbjct: 250 EEGEKVVEEKLPNGKDVKESKKHDESSTNVNKENVGGCCQGSNGFSCCRDGNLGANEEKK 309 Query: 50 GK----------VGGLSSWVGKWEQ 6 K +G LSSW+ EQ Sbjct: 310 AKEIGEVRGKKRLGSLSSWISSLEQ 334 >emb|CBI34859.3| unnamed protein product [Vitis vinifera] Length = 330 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 11/80 (13%) Frame = -1 Query: 212 KEAEKVEEPKIANGTVEKQP----QDISNGKNTESVGGCCQGSNGFSCCRDADV-----E 60 +E EKV+E K+ NG +K+ +D + N ESV GCCQG++G SCCRDA + Sbjct: 224 EEGEKVDEQKLPNGKDQKRKKKHQEDSPSLGNKESVAGCCQGADGVSCCRDATLVDKCTS 283 Query: 59 EKPGK--VGGLSSWVGKWEQ 6 E+ GK + LS W+G WEQ Sbjct: 284 EEQGKKVLTKLSHWMGTWEQ 303 >ref|XP_002273410.1| PREDICTED: altered inheritance of mitochondria protein 32 [Vitis vinifera] Length = 399 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 11/80 (13%) Frame = -1 Query: 212 KEAEKVEEPKIANGTVEKQP----QDISNGKNTESVGGCCQGSNGFSCCRDADV-----E 60 +E EKV+E K+ NG +K+ +D + N ESV GCCQG++G SCCRDA + Sbjct: 293 EEGEKVDEQKLPNGKDQKRKKKHQEDSPSLGNKESVAGCCQGADGVSCCRDATLVDKCTS 352 Query: 59 EKPGK--VGGLSSWVGKWEQ 6 E+ GK + LS W+G WEQ Sbjct: 353 EEQGKKVLTKLSHWMGTWEQ 372 >gb|AAB33256.1| Clostridium pasteurianum ferredoxin homolog [Solanum tuberosum] Length = 322 Score = 62.8 bits (151), Expect = 3e-08 Identities = 33/74 (44%), Positives = 45/74 (60%), Gaps = 4/74 (5%) Frame = -1 Query: 212 KEAEKVEEPKIANGTVEKQPQDISNGKNTESVGG--CCQGSNGFSCCRDADVEEKPGK-- 45 K +KV+E K+ T E++ + + NG SV CCQG+ G SCCRDA E++ K Sbjct: 224 KVTDKVDEQKVPEVTNEEK-KPLENGSQESSVTSFSCCQGAAGVSCCRDASAEQEENKKG 282 Query: 44 VGGLSSWVGKWEQR 3 G +S+W GKWEQR Sbjct: 283 QGTVSNWFGKWEQR 296 >ref|XP_004168334.1| PREDICTED: altered inheritance of mitochondria protein 32-like [Cucumis sativus] Length = 363 Score = 62.0 bits (149), Expect = 5e-08 Identities = 34/89 (38%), Positives = 44/89 (49%), Gaps = 20/89 (22%) Frame = -1 Query: 212 KEAEKVEEPKIANGTVEKQP----QDISNGKNTESVGGCCQGSNGFSCCRD------ADV 63 +E +K E K+ NG K+ Q+ N E V CCQGSNGF+CCRD + + Sbjct: 248 EEVQKEGEQKLPNGEDTKENKVEIQENGNQSKVEPVASCCQGSNGFTCCRDESSGKSSSI 307 Query: 62 EEKPGKVGG----------LSSWVGKWEQ 6 EEKP ++ S W GKWEQ Sbjct: 308 EEKPKEISNDEQVPTIASKFSCWTGKWEQ 336