BLASTX nr result
ID: Scutellaria24_contig00006946
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00006946 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512390.1| AMP-activated protein kinase, gamma regulato... 57 1e-06 ref|XP_002314455.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 ref|XP_002319007.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002512390.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] gi|223548351|gb|EEF49842.1| AMP-activated protein kinase, gamma regulatory subunit, putative [Ricinus communis] Length = 540 Score = 57.4 bits (137), Expect = 1e-06 Identities = 34/70 (48%), Positives = 47/70 (67%), Gaps = 2/70 (2%) Frame = +3 Query: 6 KLRHHRDIIGHMVPFQRRPLVHAGPDESLANVASRILHNNISAIPFIDST--NGSCSRLL 179 KL +R I G + R L+HAGP +SL +VA +IL NN+S IP I S+ +GS +LL Sbjct: 236 KLHLNRQIDGDGRAYPRS-LIHAGPYDSLKDVALKILQNNVSTIPIIHSSSRDGSFPQLL 294 Query: 180 HVACLAGVLK 209 H+A L+G+LK Sbjct: 295 HLASLSGILK 304 >ref|XP_002314455.1| predicted protein [Populus trichocarpa] gi|222863495|gb|EEF00626.1| predicted protein [Populus trichocarpa] Length = 447 Score = 55.1 bits (131), Expect = 6e-06 Identities = 30/66 (45%), Positives = 44/66 (66%), Gaps = 2/66 (3%) Frame = +3 Query: 18 HRDIIGHMVPFQRRPLVHAGPDESLANVASRILHNNISAIPFIDST--NGSCSRLLHVAC 191 +R I GH+ R L+HAGP ++L VA RIL N ++ +P I S+ +GS +LLH+A Sbjct: 212 NRQIDGHVRALPRH-LIHAGPYDNLKEVALRILQNEVATVPIIHSSSEDGSFPQLLHLAS 270 Query: 192 LAGVLK 209 L+G+LK Sbjct: 271 LSGILK 276 >ref|XP_002319007.1| predicted protein [Populus trichocarpa] gi|222857383|gb|EEE94930.1| predicted protein [Populus trichocarpa] Length = 488 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/51 (52%), Positives = 40/51 (78%), Gaps = 2/51 (3%) Frame = +3 Query: 63 LVHAGPDESLANVASRILHNNISAIPFIDST--NGSCSRLLHVACLAGVLK 209 L+HAGP +SL +VAS+IL N+IS +P + S+ +GS +LLH+A L+G+LK Sbjct: 264 LIHAGPYDSLKDVASKILQNSISTVPILHSSAQDGSFPQLLHLASLSGILK 314