BLASTX nr result
ID: Scutellaria24_contig00006910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00006910 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280965.1| PREDICTED: caseinolytic peptidase B protein ... 65 7e-09 ref|XP_004147653.1| PREDICTED: ESX-1 secretion system protein Ec... 62 4e-08 ref|XP_002514299.1| Protein cbxX, chromosomal, putative [Ricinus... 57 2e-06 ref|XP_002324992.1| predicted protein [Populus trichocarpa] gi|2... 54 1e-05 >ref|XP_002280965.1| PREDICTED: caseinolytic peptidase B protein homolog [Vitis vinifera] gi|297738825|emb|CBI28070.3| unnamed protein product [Vitis vinifera] Length = 484 Score = 64.7 bits (156), Expect = 7e-09 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = +3 Query: 114 MQKMKNQLPKSSKPTTIHGFAQFEDINAFQKLLRDNPSLLNDRNPVVCK 260 MQ+ +Q +SSKPTTIHG AQ D+ A QKLLR NPSLLNDRNPV+ + Sbjct: 1 MQRPLDQRSRSSKPTTIHGCAQSGDLLALQKLLRGNPSLLNDRNPVMAQ 49 >ref|XP_004147653.1| PREDICTED: ESX-1 secretion system protein EccA1-like [Cucumis sativus] gi|449498823|ref|XP_004160644.1| PREDICTED: ESX-1 secretion system protein EccA1-like [Cucumis sativus] Length = 479 Score = 62.4 bits (150), Expect = 4e-08 Identities = 29/45 (64%), Positives = 37/45 (82%) Frame = +3 Query: 114 MQKMKNQLPKSSKPTTIHGFAQFEDINAFQKLLRDNPSLLNDRNP 248 MQK ++Q +S+KPTTIHG+AQ DI + QKLLR+NP LLN+RNP Sbjct: 1 MQKPQDQRLRSTKPTTIHGYAQSGDILSLQKLLRENPGLLNERNP 45 >ref|XP_002514299.1| Protein cbxX, chromosomal, putative [Ricinus communis] gi|223546755|gb|EEF48253.1| Protein cbxX, chromosomal, putative [Ricinus communis] Length = 481 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +3 Query: 129 NQLPKSSKP-TTIHGFAQFEDINAFQKLLRDNPSLLNDRNPVVCK 260 +Q +SSK TTIHGFAQ D+ AFQKLLR NPSLLN+RNPV+ + Sbjct: 7 DQRSRSSKQVTTIHGFAQSGDLLAFQKLLRVNPSLLNERNPVMAQ 51 >ref|XP_002324992.1| predicted protein [Populus trichocarpa] gi|222866426|gb|EEF03557.1| predicted protein [Populus trichocarpa] Length = 477 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +3 Query: 141 KSSKPTTIHGFAQFEDINAFQKLLRDNPSLLNDRNPVVCK 260 +SSKP TIH +AQ D+ FQ+LLR +PSLLN+RNPV+ + Sbjct: 11 RSSKPATIHSYAQSGDLLGFQRLLRGDPSLLNERNPVMAQ 50