BLASTX nr result
ID: Scutellaria24_contig00006648
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00006648 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306185.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_002278879.1| PREDICTED: uncharacterized protein LOC100260... 58 7e-07 ref|XP_003522651.1| PREDICTED: uncharacterized protein LOC100780... 57 2e-06 ref|XP_002534419.1| metal ion binding protein, putative [Ricinus... 56 3e-06 >ref|XP_002306185.1| predicted protein [Populus trichocarpa] gi|222849149|gb|EEE86696.1| predicted protein [Populus trichocarpa] Length = 154 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 100 MGALDHLSNIFDCSGGHSKLKKRKQLQTVEIKI 2 MGALDHLS FDCS G SKLKKR+QLQTVE+K+ Sbjct: 1 MGALDHLSGFFDCSSGSSKLKKRRQLQTVEVKV 33 >ref|XP_002278879.1| PREDICTED: uncharacterized protein LOC100260571 isoform 1 [Vitis vinifera] gi|359475023|ref|XP_003631570.1| PREDICTED: uncharacterized protein LOC100260571 isoform 2 [Vitis vinifera] gi|147802513|emb|CAN62146.1| hypothetical protein VITISV_016892 [Vitis vinifera] gi|297744607|emb|CBI37869.3| unnamed protein product [Vitis vinifera] Length = 155 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -1 Query: 100 MGALDHLSNIFDCSGGHSKLKKRKQLQTVEIKI 2 MGALDH+S++FDCS G SKLK+RKQLQTVEIK+ Sbjct: 1 MGALDHVSHLFDCSHGSSKLKRRKQLQTVEIKV 33 >ref|XP_003522651.1| PREDICTED: uncharacterized protein LOC100780624 [Glycine max] Length = 163 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -1 Query: 100 MGALDHLSNIFDCSGGHSKLKKRKQLQTVEIKI 2 MGALDH+S +FDCS G SK KKRKQLQTVE+K+ Sbjct: 10 MGALDHISELFDCSSGSSKHKKRKQLQTVEVKV 42 >ref|XP_002534419.1| metal ion binding protein, putative [Ricinus communis] gi|223525324|gb|EEF27963.1| metal ion binding protein, putative [Ricinus communis] Length = 154 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -1 Query: 100 MGALDHLSNIFDCSGGHSKLKKRKQLQTVEIKI 2 MGALDH S++FDCS G SK KKRKQLQTVEIK+ Sbjct: 1 MGALDHFSHLFDCSHGSSKHKKRKQLQTVEIKV 33