BLASTX nr result
ID: Scutellaria24_contig00006420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00006420 (765 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002263416.1| PREDICTED: tRNA pseudouridine synthase A [Vi... 139 7e-31 ref|XP_002526453.1| pseudouridylate synthase, putative [Ricinus ... 137 3e-30 ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-lik... 135 7e-30 ref|XP_004161929.1| PREDICTED: tRNA pseudouridine synthase A-lik... 133 4e-29 ref|XP_004135354.1| PREDICTED: tRNA pseudouridine synthase A-lik... 133 4e-29 >ref|XP_002263416.1| PREDICTED: tRNA pseudouridine synthase A [Vitis vinifera] gi|297739525|emb|CBI29707.3| unnamed protein product [Vitis vinifera] Length = 380 Score = 139 bits (350), Expect = 7e-31 Identities = 73/116 (62%), Positives = 85/116 (73%), Gaps = 1/116 (0%) Frame = -3 Query: 763 QNNYASTGSVSISNKLQT-DSTTDVDPKQLAKSSVGEAVQGFGVRKRHRCFVVTARARSF 587 QNN+ ++ SN + DS + + +L A QGFGVR+RHRCF+VTARARSF Sbjct: 267 QNNFTEENPLACSNNAEVPDSPSTANHDRL--DGFNGAGQGFGVRRRHRCFLVTARARSF 324 Query: 586 LYHQVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLP 419 LYHQVRLLVGV+K VGTG LT+SDV+RIL AK V ASPMAPACGLYLG V YDLP Sbjct: 325 LYHQVRLLVGVIKCVGTGDLTVSDVERILNAKTVTAASPMAPACGLYLGNVNYDLP 380 >ref|XP_002526453.1| pseudouridylate synthase, putative [Ricinus communis] gi|223534233|gb|EEF35948.1| pseudouridylate synthase, putative [Ricinus communis] Length = 372 Score = 137 bits (344), Expect = 3e-30 Identities = 77/114 (67%), Positives = 84/114 (73%), Gaps = 6/114 (5%) Frame = -3 Query: 742 GSVSISNKLQTD------STTDVDPKQLAKSSVGEAVQGFGVRKRHRCFVVTARARSFLY 581 G S K +TD S T+V A+SS GE GFG+R+RHRCFVVTARARSFLY Sbjct: 264 GENSCCKKFKTDLPMGSHSNTNV-----AESSFGETDLGFGIRRRHRCFVVTARARSFLY 318 Query: 580 HQVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLP 419 HQVRLLVGVLKSVG G LT SDV+RIL AK+V ASPMAPA GLYLG VKYDLP Sbjct: 319 HQVRLLVGVLKSVGIGDLTTSDVERILSAKSVTAASPMAPARGLYLGHVKYDLP 372 >ref|XP_003540148.1| PREDICTED: tRNA pseudouridine synthase A-like [Glycine max] Length = 369 Score = 135 bits (341), Expect = 7e-30 Identities = 73/116 (62%), Positives = 83/116 (71%) Frame = -3 Query: 763 QNNYASTGSVSISNKLQTDSTTDVDPKQLAKSSVGEAVQGFGVRKRHRCFVVTARARSFL 584 Q+N S S SN +TD +P + K GFG R+RHRC VVTARARSFL Sbjct: 254 QHNKVSGDLRSCSNNTETDIPPISNPS-IDKVITSSQDAGFGKRRRHRCLVVTARARSFL 312 Query: 583 YHQVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPMAPACGLYLGQVKYDLPS 416 YHQVRLLVGVLK+ GTG+LTI DV+RIL AK V ASPMAPACGLYLG+VKYDLP+ Sbjct: 313 YHQVRLLVGVLKAAGTGNLTIPDVERILNAKTVTAASPMAPACGLYLGEVKYDLPT 368 >ref|XP_004161929.1| PREDICTED: tRNA pseudouridine synthase A-like [Cucumis sativus] Length = 352 Score = 133 bits (335), Expect = 4e-29 Identities = 63/76 (82%), Positives = 69/76 (90%) Frame = -3 Query: 646 GFGVRKRHRCFVVTARARSFLYHQVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPM 467 GFG+R+RHRCFVVTARARSFLYHQVRL+VGVLK+VG+G LT+ DV RILEAKNV A PM Sbjct: 273 GFGIRRRHRCFVVTARARSFLYHQVRLMVGVLKAVGSGDLTVGDVGRILEAKNVSSARPM 332 Query: 466 APACGLYLGQVKYDLP 419 APACGLYLG VKYDLP Sbjct: 333 APACGLYLGHVKYDLP 348 >ref|XP_004135354.1| PREDICTED: tRNA pseudouridine synthase A-like [Cucumis sativus] Length = 350 Score = 133 bits (335), Expect = 4e-29 Identities = 63/76 (82%), Positives = 69/76 (90%) Frame = -3 Query: 646 GFGVRKRHRCFVVTARARSFLYHQVRLLVGVLKSVGTGHLTISDVKRILEAKNVGLASPM 467 GFG+R+RHRCFVVTARARSFLYHQVRL+VGVLK+VG+G LT+ DV RILEAKNV A PM Sbjct: 271 GFGIRRRHRCFVVTARARSFLYHQVRLMVGVLKAVGSGDLTVGDVGRILEAKNVSSARPM 330 Query: 466 APACGLYLGQVKYDLP 419 APACGLYLG VKYDLP Sbjct: 331 APACGLYLGHVKYDLP 346