BLASTX nr result
ID: Scutellaria24_contig00005361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00005361 (1213 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269112.1| PREDICTED: mitochondrial inner membrane prot... 87 6e-15 ref|XP_002526954.1| protein with unknown function [Ricinus commu... 85 4e-14 ref|XP_002301724.1| predicted protein [Populus trichocarpa] gi|2... 85 4e-14 ref|XP_002300068.1| predicted protein [Populus trichocarpa] gi|2... 84 9e-14 ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane prot... 82 4e-13 >ref|XP_002269112.1| PREDICTED: mitochondrial inner membrane protease ATP23 [Vitis vinifera] gi|296081332|emb|CBI17714.3| unnamed protein product [Vitis vinifera] Length = 195 Score = 87.4 bits (215), Expect = 6e-15 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = -3 Query: 335 KDCVRRRVMKSVTANPNCSNTAAKAAMEAVWDICYNDTKPFDRAP 201 ++CVRRRVMKSVTANP+CS AAK AMEAVWD+CYNDTKPFDRAP Sbjct: 151 QECVRRRVMKSVTANPHCSEAAAKDAMEAVWDVCYNDTKPFDRAP 195 >ref|XP_002526954.1| protein with unknown function [Ricinus communis] gi|223533706|gb|EEF35441.1| protein with unknown function [Ricinus communis] Length = 187 Score = 84.7 bits (208), Expect = 4e-14 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -3 Query: 338 EKDCVRRRVMKSVTANPNCSNTAAKAAMEAVWDICYNDTKPFDRAP 201 E++CVRRRVMKS+ ANP CS AAK AMEAVWD+CYNDTKPFDRAP Sbjct: 142 EQECVRRRVMKSMIANPYCSEAAAKDAMEAVWDVCYNDTKPFDRAP 187 >ref|XP_002301724.1| predicted protein [Populus trichocarpa] gi|222843450|gb|EEE80997.1| predicted protein [Populus trichocarpa] Length = 174 Score = 84.7 bits (208), Expect = 4e-14 Identities = 36/46 (78%), Positives = 42/46 (91%) Frame = -3 Query: 338 EKDCVRRRVMKSVTANPNCSNTAAKAAMEAVWDICYNDTKPFDRAP 201 E++CVRRRVMKSV ANP+CS AA+ AMEAVWD+CYNDT+PFDRAP Sbjct: 129 EQECVRRRVMKSVIANPHCSEAAARDAMEAVWDVCYNDTRPFDRAP 174 >ref|XP_002300068.1| predicted protein [Populus trichocarpa] gi|222847326|gb|EEE84873.1| predicted protein [Populus trichocarpa] Length = 187 Score = 83.6 bits (205), Expect = 9e-14 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -3 Query: 338 EKDCVRRRVMKSVTANPNCSNTAAKAAMEAVWDICYNDTKPFDRAP 201 E+DCV+RRVMKS+ ANP CS AAK AMEAVWD+CYNDT+PFDRAP Sbjct: 142 EQDCVKRRVMKSMIANPYCSKAAAKDAMEAVWDVCYNDTQPFDRAP 187 >ref|XP_004142774.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] gi|449483813|ref|XP_004156699.1| PREDICTED: mitochondrial inner membrane protease ATP23-like [Cucumis sativus] Length = 195 Score = 81.6 bits (200), Expect = 4e-13 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -3 Query: 338 EKDCVRRRVMKSVTANPNCSNTAAKAAMEAVWDICYNDTKPFDRAP 201 E++CVRRRVMKS+ ANP C AAK AMEAVWD+CYNDT+PFDRAP Sbjct: 150 EQECVRRRVMKSLVANPYCPEAAAKDAMEAVWDVCYNDTQPFDRAP 195