BLASTX nr result
ID: Scutellaria24_contig00005360
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00005360 (390 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521807.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 dbj|BAJ53253.1| JHL25P11.1 [Jatropha curcas] 59 3e-07 >ref|XP_002521807.1| conserved hypothetical protein [Ricinus communis] gi|223539020|gb|EEF40617.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 60.1 bits (144), Expect = 2e-07 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = +2 Query: 239 SWLNXXXXXYLILILCSPFLIPLLCATCPFICAIEVCFLICRRRRAAEDG 388 SWL + L+LCSP L+P LCA+ P +CA E+C ICRR R +DG Sbjct: 55 SWLRMRRSRCVFLLLCSPILLPFLCASFPLLCAAELCIRICRRARRRKDG 104 >dbj|BAJ53253.1| JHL25P11.1 [Jatropha curcas] Length = 180 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/50 (50%), Positives = 32/50 (64%) Frame = +2 Query: 239 SWLNXXXXXYLILILCSPFLIPLLCATCPFICAIEVCFLICRRRRAAEDG 388 SWL L LILCSP L+P LCA P +CA+E+C ICRR + ++G Sbjct: 58 SWLRTRRSRCLFLILCSPILLPFLCAIFPLLCAVELCIRICRRGQRMKEG 107