BLASTX nr result
ID: Scutellaria24_contig00005323
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00005323 (362 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539735.1| PREDICTED: interactor of constitutive active... 62 6e-08 gb|ACU17370.1| unknown [Glycine max] 62 6e-08 ref|XP_003538038.1| PREDICTED: interactor of constitutive active... 61 8e-08 ref|XP_003537260.1| PREDICTED: interactor of constitutive active... 59 5e-07 ref|XP_002282027.2| PREDICTED: interactor of constitutive active... 58 9e-07 >ref|XP_003539735.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform 1 [Glycine max] gi|356542563|ref|XP_003539736.1| PREDICTED: interactor of constitutive active ROPs 3-like isoform 2 [Glycine max] Length = 615 Score = 61.6 bits (148), Expect = 6e-08 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 9/68 (13%) Frame = +3 Query: 186 KMSPRYT---EPTT------SSSNFATKPPKERSPKVSDHKSPRSPLFQKKHSRGVAKLE 338 K+SPR +PTT SS + ATK KERSPKV+D +SPRSP+ ++K +++LE Sbjct: 16 KVSPRAVRQLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVIERKRPSKISELE 75 Query: 339 SQISQLEN 362 SQISQL+N Sbjct: 76 SQISQLQN 83 >gb|ACU17370.1| unknown [Glycine max] Length = 155 Score = 61.6 bits (148), Expect = 6e-08 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 9/68 (13%) Frame = +3 Query: 186 KMSPRYT---EPTT------SSSNFATKPPKERSPKVSDHKSPRSPLFQKKHSRGVAKLE 338 K+SPR +PTT SS + ATK KERSPKV+D +SPRSP+ ++K +++LE Sbjct: 16 KVSPRAVRQLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVIERKRPSKISELE 75 Query: 339 SQISQLEN 362 SQISQL+N Sbjct: 76 SQISQLQN 83 >ref|XP_003538038.1| PREDICTED: interactor of constitutive active ROPs 3-like [Glycine max] Length = 615 Score = 61.2 bits (147), Expect = 8e-08 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 9/68 (13%) Frame = +3 Query: 186 KMSPRYT---EPTT------SSSNFATKPPKERSPKVSDHKSPRSPLFQKKHSRGVAKLE 338 K+SPR +PTT SS + ATK KERSPKV+D +SPRSP+ ++K +++LE Sbjct: 16 KVSPRAVRKLKPTTLDIDSASSLSQATKSSKERSPKVTDRRSPRSPVVERKRPSKISELE 75 Query: 339 SQISQLEN 362 SQISQL+N Sbjct: 76 SQISQLQN 83 >ref|XP_003537260.1| PREDICTED: interactor of constitutive active ROPs 2, chloroplastic-like [Glycine max] Length = 626 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/61 (49%), Positives = 41/61 (67%) Frame = +3 Query: 177 RQLKMSPRYTEPTTSSSNFATKPPKERSPKVSDHKSPRSPLFQKKHSRGVAKLESQISQL 356 R+LK T+ +SS +K PK RSPKV++ KSPRSP+ +KK V +LESQ++QL Sbjct: 26 RKLKTPGSDTDSVSSSPKPGSKTPKNRSPKVTERKSPRSPISEKKRPGRVQELESQLAQL 85 Query: 357 E 359 E Sbjct: 86 E 86 >ref|XP_002282027.2| PREDICTED: interactor of constitutive active ROPs 3-like [Vitis vinifera] Length = 624 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/61 (49%), Positives = 45/61 (73%) Frame = +3 Query: 177 RQLKMSPRYTEPTTSSSNFATKPPKERSPKVSDHKSPRSPLFQKKHSRGVAKLESQISQL 356 RQLK + ++ + SSSN A++ PK++SPKV + +SPRSP+ +KK V +LESQIS+L Sbjct: 24 RQLKTTSLESD-SASSSNQASRTPKDKSPKVIERRSPRSPVSEKKRPNKVTELESQISKL 82 Query: 357 E 359 + Sbjct: 83 Q 83