BLASTX nr result
ID: Scutellaria24_contig00005261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00005261 (327 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003611467.1| hypothetical protein MTR_5g014270 [Medicago ... 71 8e-11 >ref|XP_003611467.1| hypothetical protein MTR_5g014270 [Medicago truncatula] gi|355512802|gb|AES94425.1| hypothetical protein MTR_5g014270 [Medicago truncatula] Length = 60 Score = 71.2 bits (173), Expect = 8e-11 Identities = 35/49 (71%), Positives = 41/49 (83%), Gaps = 2/49 (4%) Frame = -3 Query: 319 KKREKKNWVIDPP--KWVALTDVLLTGKARRLFPSLSGEMPTISPFYEH 179 KK+ KKNWVIDP +W+ALT+V KAR+LFPSLSGEMPTISPF+EH Sbjct: 10 KKKGKKNWVIDPTSKRWIALTEVC-NRKARKLFPSLSGEMPTISPFHEH 57