BLASTX nr result
ID: Scutellaria24_contig00005196
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00005196 (449 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|P85524.1|KIRO_ACTDE RecName: Full=Kirola; AltName: Allergen=A... 65 8e-09 gb|AFV29675.1| major latex-like protein, partial [Senecio aethne... 60 2e-07 gb|ACH72969.1| major latex-like protein [Panax ginseng] 59 3e-07 ref|XP_002284516.1| PREDICTED: MLP-like protein 28 [Vitis vinifera] 57 2e-06 ref|XP_002284513.1| PREDICTED: ripening-related protein-like [Vi... 55 5e-06 >sp|P85524.1|KIRO_ACTDE RecName: Full=Kirola; AltName: Allergen=Act d 11 Length = 150 Score = 64.7 bits (156), Expect = 8e-09 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -2 Query: 448 FKAIEGAILDGYKALRTILDVDTNGEDNHVITWTIEYEKESEGVSEPHEVMNFLIDFTKQ 269 FK +EG +++ YK I+ VDT GE N V TWT YEK E V EP+ +MNF I+ TK Sbjct: 85 FKIVEGDLMELYKTFIIIVQVDTKGEHNSV-TWTFHYEKLKEDVEEPNTLMNFCIEITKD 143 Query: 268 IE 263 IE Sbjct: 144 IE 145 >gb|AFV29675.1| major latex-like protein, partial [Senecio aethnensis] Length = 76 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = -2 Query: 448 FKAIEGAILDGYKALRTILDVDTNGEDNHVITWTIEYEKESEGVSEPHEVMNFLID 281 FK IEG +++ YK+ + VDT GE+N ++TWT+ YEK ++ V +PH M FL+D Sbjct: 22 FKVIEGNLMELYKSFLITVHVDTKGEEN-LVTWTVTYEKLNDNVEDPHTFMEFLVD 76 >gb|ACH72969.1| major latex-like protein [Panax ginseng] Length = 151 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/62 (41%), Positives = 43/62 (69%) Frame = -2 Query: 448 FKAIEGAILDGYKALRTILDVDTNGEDNHVITWTIEYEKESEGVSEPHEVMNFLIDFTKQ 269 FK +EG + + +K++ + VDT GEDN ++TW+I+YEK +E V +P ++FL+ T+ Sbjct: 85 FKVVEGHLFEEFKSIVFSVHVDTKGEDN-LVTWSIDYEKLNESVKDPTSYLDFLLSVTRD 143 Query: 268 IE 263 IE Sbjct: 144 IE 145 >ref|XP_002284516.1| PREDICTED: MLP-like protein 28 [Vitis vinifera] Length = 151 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/68 (44%), Positives = 41/68 (60%) Frame = -2 Query: 448 FKAIEGAILDGYKALRTILDVDTNGEDNHVITWTIEYEKESEGVSEPHEVMNFLIDFTKQ 269 FK ++G +L YK+ + GE + VI WTIEYEK SEG +PH + F ++ TK Sbjct: 85 FKVLDGEVLKEYKSYKFTAQAIPKGEGSLVI-WTIEYEKASEGGPDPHNYLEFAVNITKD 143 Query: 268 IEHNSHVL 245 IE SH+L Sbjct: 144 IE--SHLL 149 >ref|XP_002284513.1| PREDICTED: ripening-related protein-like [Vitis vinifera] gi|147865627|emb|CAN83049.1| hypothetical protein VITISV_030287 [Vitis vinifera] gi|297737685|emb|CBI26886.3| unnamed protein product [Vitis vinifera] Length = 151 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/68 (44%), Positives = 40/68 (58%) Frame = -2 Query: 448 FKAIEGAILDGYKALRTILDVDTNGEDNHVITWTIEYEKESEGVSEPHEVMNFLIDFTKQ 269 FK ++G +L YK+ + GE VI WTIEYEK SEG +PH + F ++ TK Sbjct: 85 FKVLDGEVLKDYKSYKFTTQAIPKGEGCLVI-WTIEYEKASEGGPDPHNCLEFSVNITKD 143 Query: 268 IEHNSHVL 245 IE SH+L Sbjct: 144 IE--SHLL 149