BLASTX nr result
ID: Scutellaria24_contig00004802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00004802 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003622988.1| General transcription factor 3C polypeptide ... 77 2e-12 ref|XP_002323927.1| predicted protein [Populus trichocarpa] gi|2... 76 3e-12 emb|CBI24753.3| unnamed protein product [Vitis vinifera] 75 6e-12 ref|XP_002275875.1| PREDICTED: transcription factor tau subunit ... 75 6e-12 ref|XP_002529107.1| conserved hypothetical protein [Ricinus comm... 75 6e-12 >ref|XP_003622988.1| General transcription factor 3C polypeptide [Medicago truncatula] gi|355498003|gb|AES79206.1| General transcription factor 3C polypeptide [Medicago truncatula] Length = 612 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/53 (66%), Positives = 45/53 (84%) Frame = +1 Query: 163 MGIIKDGSISGVLPSSSETFAVHYPGYPSSTQRAIETLGGTQGILKVRAEKSN 321 MG+IKDG+ISGVLP + F VHYPGYPS+T RA++TLGG+QGILK R+ ++N Sbjct: 6 MGVIKDGTISGVLPEP-QGFLVHYPGYPSTTSRAVDTLGGSQGILKARSSQAN 57 >ref|XP_002323927.1| predicted protein [Populus trichocarpa] gi|222866929|gb|EEF04060.1| predicted protein [Populus trichocarpa] Length = 527 Score = 75.9 bits (185), Expect = 3e-12 Identities = 35/53 (66%), Positives = 44/53 (83%) Frame = +1 Query: 163 MGIIKDGSISGVLPSSSETFAVHYPGYPSSTQRAIETLGGTQGILKVRAEKSN 321 MG+IK+G +SG++PS E FAVHYPGYPSS RAI+TLGGT+ ILK R+ +SN Sbjct: 1 MGVIKEGKVSGLIPSK-EGFAVHYPGYPSSISRAIQTLGGTESILKARSSQSN 52 >emb|CBI24753.3| unnamed protein product [Vitis vinifera] Length = 597 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +1 Query: 163 MGIIKDGSISGVLPSSSETFAVHYPGYPSSTQRAIETLGGTQGILKVRAEKSN 321 MG+I++GSISG +PS+ E F+VHYP YPSST RAIETLGGTQ I K R+ +SN Sbjct: 1 MGVIEEGSISGYIPSN-EAFSVHYPAYPSSTARAIETLGGTQAIRKARSSQSN 52 >ref|XP_002275875.1| PREDICTED: transcription factor tau subunit sfc1-like [Vitis vinifera] Length = 568 Score = 75.1 bits (183), Expect = 6e-12 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +1 Query: 163 MGIIKDGSISGVLPSSSETFAVHYPGYPSSTQRAIETLGGTQGILKVRAEKSN 321 MG+I++GSISG +PS+ E F+VHYP YPSST RAIETLGGTQ I K R+ +SN Sbjct: 1 MGVIEEGSISGYIPSN-EAFSVHYPAYPSSTARAIETLGGTQAIRKARSSQSN 52 >ref|XP_002529107.1| conserved hypothetical protein [Ricinus communis] gi|223531458|gb|EEF33291.1| conserved hypothetical protein [Ricinus communis] Length = 540 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/53 (66%), Positives = 42/53 (79%) Frame = +1 Query: 163 MGIIKDGSISGVLPSSSETFAVHYPGYPSSTQRAIETLGGTQGILKVRAEKSN 321 MG+IK+G SG++PS+ E FAVHYPGYPSS RAI+TLGGT ILK R +SN Sbjct: 1 MGVIKEGEASGIIPSN-EAFAVHYPGYPSSISRAIQTLGGTDAILKARTSQSN 52