BLASTX nr result
ID: Scutellaria24_contig00004382
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00004382 (387 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513324.1| conserved hypothetical protein [Ricinus comm... 95 7e-18 ref|XP_002316436.1| predicted protein [Populus trichocarpa] gi|2... 92 3e-17 gb|ADE76860.1| unknown [Picea sitchensis] 90 2e-16 ref|XP_002311904.1| predicted protein [Populus trichocarpa] gi|2... 90 2e-16 ref|XP_002887759.1| hypothetical protein ARALYDRAFT_477053 [Arab... 89 5e-16 >ref|XP_002513324.1| conserved hypothetical protein [Ricinus communis] gi|223547232|gb|EEF48727.1| conserved hypothetical protein [Ricinus communis] Length = 177 Score = 94.7 bits (234), Expect = 7e-18 Identities = 46/75 (61%), Positives = 56/75 (74%), Gaps = 3/75 (4%) Frame = -3 Query: 229 DVIHSFIVKRSKPDWLPFLPGASYWVPPRRI---SYGVAEVVNNLANALTDEEYLSLTTL 59 D IH IV+R+ PDWLPFLPG+SYWVPP R S G+A++V LAN LTDE+ LS TT+ Sbjct: 55 DAIHRIIVRRAAPDWLPFLPGSSYWVPPPRSTGGSLGIAQLVEKLANPLTDEQSLSTTTV 114 Query: 58 QGWPSSAFYIHNDAS 14 +GWPSS F+ DAS Sbjct: 115 RGWPSSDFFF-QDAS 128 >ref|XP_002316436.1| predicted protein [Populus trichocarpa] gi|222865476|gb|EEF02607.1| predicted protein [Populus trichocarpa] Length = 167 Score = 92.4 bits (228), Expect = 3e-17 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 3/75 (4%) Frame = -3 Query: 229 DVIHSFIVKRSKPDWLPFLPGASYWVPPRRI---SYGVAEVVNNLANALTDEEYLSLTTL 59 D IH IV+R+ PDWLPFLPG+SYWVPP R S G+A +V LAN L+DEE LS +T+ Sbjct: 64 DAIHGIIVRRAAPDWLPFLPGSSYWVPPPRSASGSLGIAHLVEKLANPLSDEESLSTSTV 123 Query: 58 QGWPSSAFYIHNDAS 14 +GWPSS +++ +S Sbjct: 124 RGWPSSDYFVKGASS 138 >gb|ADE76860.1| unknown [Picea sitchensis] Length = 166 Score = 89.7 bits (221), Expect = 2e-16 Identities = 39/68 (57%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = -3 Query: 229 DVIHSFIVKRSKPDWLPFLPGASYWVPPRRISYGVAEVVNNLA-NALTDEEYLSLTTLQG 53 D IH +V+R+ PDWLPFLPGASYWVPPR+ + + E++ L+ N++T EE LS TT +G Sbjct: 76 DAIHGILVRRAAPDWLPFLPGASYWVPPRKNNGSLVELLGRLSNNSMTQEESLSFTTSRG 135 Query: 52 WPSSAFYI 29 WPSSA++I Sbjct: 136 WPSSAYFI 143 >ref|XP_002311904.1| predicted protein [Populus trichocarpa] gi|222851724|gb|EEE89271.1| predicted protein [Populus trichocarpa] Length = 165 Score = 89.7 bits (221), Expect = 2e-16 Identities = 41/70 (58%), Positives = 52/70 (74%), Gaps = 3/70 (4%) Frame = -3 Query: 229 DVIHSFIVKRSKPDWLPFLPGASYWVPPRRI---SYGVAEVVNNLANALTDEEYLSLTTL 59 D IH IV+R+ PDWLPFLPG+SYWVP R S G+A +V LAN L+DEE LS TT+ Sbjct: 62 DAIHRIIVRRAAPDWLPFLPGSSYWVPSPRSTSGSLGIAHLVEKLANPLSDEESLSTTTV 121 Query: 58 QGWPSSAFYI 29 +GWPSS +++ Sbjct: 122 RGWPSSDYFV 131 >ref|XP_002887759.1| hypothetical protein ARALYDRAFT_477053 [Arabidopsis lyrata subsp. lyrata] gi|297333600|gb|EFH64018.1| hypothetical protein ARALYDRAFT_477053 [Arabidopsis lyrata subsp. lyrata] Length = 152 Score = 88.6 bits (218), Expect = 5e-16 Identities = 36/68 (52%), Positives = 55/68 (80%), Gaps = 1/68 (1%) Frame = -3 Query: 229 DVIHSFIVKRSKPDWLPFLPGASYWV-PPRRISYGVAEVVNNLANALTDEEYLSLTTLQG 53 D +H +V+RS PDWLPF+PGASYWV PPR ++G+A++V LAN ++DEE +S+++++G Sbjct: 61 DAVHRIMVRRSAPDWLPFVPGASYWVPPPRSQTHGIAKLVEKLANPISDEESISISSVRG 120 Query: 52 WPSSAFYI 29 WP S ++I Sbjct: 121 WPCSDYFI 128