BLASTX nr result
ID: Scutellaria24_contig00004299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00004299 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFP49341.1| thioredoxin h, partial [Olea europaea] 66 3e-09 ref|XP_002304983.1| thioredoxin-like protein [Populus trichocarp... 64 1e-08 ref|NP_172620.1| thioredoxin-like protein CXXS1 [Arabidopsis tha... 64 1e-08 gb|AAM63200.1| thioredoxin h, putative [Arabidopsis thaliana] 64 1e-08 ref|NP_001235589.1| uncharacterized protein LOC100500012 [Glycin... 64 1e-08 >gb|AFP49341.1| thioredoxin h, partial [Olea europaea] Length = 100 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -3 Query: 442 EVASKMEIKAMPTFVMIKDGIVVDKLVGANPDEIKKRV 329 E+ASKMEIKAMPTF+ +K+G VVDKLVGANP+EIKKRV Sbjct: 58 ELASKMEIKAMPTFLFMKEGAVVDKLVGANPEEIKKRV 95 >ref|XP_002304983.1| thioredoxin-like protein [Populus trichocarpa] gi|222847947|gb|EEE85494.1| thioredoxin-like protein [Populus trichocarpa] Length = 125 Score = 64.3 bits (155), Expect = 1e-08 Identities = 28/38 (73%), Positives = 36/38 (94%) Frame = -3 Query: 442 EVASKMEIKAMPTFVMIKDGIVVDKLVGANPDEIKKRV 329 EVA+KME+KAMPTFV++KDG VDK+VGANP+EI+KR+ Sbjct: 76 EVATKMEVKAMPTFVLMKDGAQVDKIVGANPEEIRKRI 113 >ref|NP_172620.1| thioredoxin-like protein CXXS1 [Arabidopsis thaliana] gi|51702018|sp|Q8LDI5.2|CXXS1_ARATH RecName: Full=Thioredoxin-like protein CXXS1; Short=AtCXXS1; AltName: Full=Mono-cysteine thioredoxin 1 gi|4973262|gb|AAD35008.1|AF144390_1 thioredoxin-like 4 [Arabidopsis thaliana] gi|6554188|gb|AAF16634.1|AC011661_12 T23J18.19 [Arabidopsis thaliana] gi|88011132|gb|ABD38907.1| At1g11530 [Arabidopsis thaliana] gi|332190627|gb|AEE28748.1| thioredoxin-like protein CXXS1 [Arabidopsis thaliana] Length = 118 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 442 EVASKMEIKAMPTFVMIKDGIVVDKLVGANPDEIKKRV 329 EVAS++E+KAMPTF+ +KDG +DKLVGANPDEIKKRV Sbjct: 68 EVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKRV 105 >gb|AAM63200.1| thioredoxin h, putative [Arabidopsis thaliana] Length = 118 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/38 (76%), Positives = 35/38 (92%) Frame = -3 Query: 442 EVASKMEIKAMPTFVMIKDGIVVDKLVGANPDEIKKRV 329 EVAS++E+KAMPTF+ +KDG +DKLVGANPDEIKKRV Sbjct: 68 EVASQLEVKAMPTFLFLKDGNAMDKLVGANPDEIKKRV 105 >ref|NP_001235589.1| uncharacterized protein LOC100500012 [Glycine max] gi|255628497|gb|ACU14593.1| unknown [Glycine max] Length = 124 Score = 63.9 bits (154), Expect = 1e-08 Identities = 27/38 (71%), Positives = 36/38 (94%) Frame = -3 Query: 442 EVASKMEIKAMPTFVMIKDGIVVDKLVGANPDEIKKRV 329 EVA+KM++KAMPTF+++KDG VDK+VGANP+EIKKR+ Sbjct: 75 EVATKMDVKAMPTFLLLKDGAAVDKVVGANPEEIKKRI 112