BLASTX nr result
ID: Scutellaria24_contig00004088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00004088 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136099.1| PREDICTED: pentatricopeptide repeat-containi... 139 3e-31 ref|XP_002263537.1| PREDICTED: pentatricopeptide repeat-containi... 130 1e-28 emb|CBI25186.3| unnamed protein product [Vitis vinifera] 130 1e-28 ref|XP_002512730.1| pentatricopeptide repeat-containing protein,... 129 2e-28 ref|XP_002332054.1| predicted protein [Populus trichocarpa] gi|2... 129 3e-28 >ref|XP_004136099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Cucumis sativus] gi|449509164|ref|XP_004163514.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Cucumis sativus] Length = 547 Score = 139 bits (349), Expect = 3e-31 Identities = 61/87 (70%), Positives = 74/87 (85%) Frame = -2 Query: 266 KAVETFHLMHKFSFSVEQKTYFVFLNILCTHGNIEEAEEFMFLNKKFFPLETESFNIILN 87 KA++TFH+M KF + +Q+ + V LN LC +GNIEEAEEFMF+NKK FPL TESFNIILN Sbjct: 199 KAIKTFHMMEKFRLTPDQEAFHVLLNSLCKYGNIEEAEEFMFVNKKLFPLGTESFNIILN 258 Query: 86 GWCSVTVDINEAKRVWREMAKCCIEPD 6 GWC+VTVD+ EAKR+WREM+KCCI PD Sbjct: 259 GWCNVTVDVFEAKRIWREMSKCCILPD 285 >ref|XP_002263537.1| PREDICTED: pentatricopeptide repeat-containing protein At1g80880, mitochondrial-like [Vitis vinifera] Length = 537 Score = 130 bits (327), Expect = 1e-28 Identities = 56/89 (62%), Positives = 71/89 (79%) Frame = -2 Query: 272 PDKAVETFHLMHKFSFSVEQKTYFVFLNILCTHGNIEEAEEFMFLNKKFFPLETESFNII 93 P KA++TFH+M KF S +Q+ ++ L LC HGN+E+AEE MF NKK FPLETE FNII Sbjct: 193 PCKAIKTFHIMEKFRLSPDQEAFYTLLTALCKHGNVEDAEELMFQNKKLFPLETEGFNII 252 Query: 92 LNGWCSVTVDINEAKRVWREMAKCCIEPD 6 LNGW +V++DI EAKR+WREM+KCCI P+ Sbjct: 253 LNGWSNVSLDIFEAKRIWREMSKCCIVPN 281 >emb|CBI25186.3| unnamed protein product [Vitis vinifera] Length = 548 Score = 130 bits (327), Expect = 1e-28 Identities = 56/89 (62%), Positives = 71/89 (79%) Frame = -2 Query: 272 PDKAVETFHLMHKFSFSVEQKTYFVFLNILCTHGNIEEAEEFMFLNKKFFPLETESFNII 93 P KA++TFH+M KF S +Q+ ++ L LC HGN+E+AEE MF NKK FPLETE FNII Sbjct: 193 PCKAIKTFHIMEKFRLSPDQEAFYTLLTALCKHGNVEDAEELMFQNKKLFPLETEGFNII 252 Query: 92 LNGWCSVTVDINEAKRVWREMAKCCIEPD 6 LNGW +V++DI EAKR+WREM+KCCI P+ Sbjct: 253 LNGWSNVSLDIFEAKRIWREMSKCCIVPN 281 >ref|XP_002512730.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547741|gb|EEF49233.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 552 Score = 129 bits (324), Expect = 2e-28 Identities = 54/89 (60%), Positives = 71/89 (79%) Frame = -2 Query: 272 PDKAVETFHLMHKFSFSVEQKTYFVFLNILCTHGNIEEAEEFMFLNKKFFPLETESFNII 93 P KA+E F++M KF + +++ ++ +N LC HG IEEAEEFM +NKK FPLETE FN+I Sbjct: 205 PGKAIEVFNIMEKFKMAPDEEAFYSLMNALCNHGYIEEAEEFMVVNKKLFPLETEGFNVI 264 Query: 92 LNGWCSVTVDINEAKRVWREMAKCCIEPD 6 LNGWCS+ V++ EAKRVWREM+KCCI P+ Sbjct: 265 LNGWCSICVNLLEAKRVWREMSKCCITPN 293 >ref|XP_002332054.1| predicted protein [Populus trichocarpa] gi|222831940|gb|EEE70417.1| predicted protein [Populus trichocarpa] Length = 444 Score = 129 bits (323), Expect = 3e-28 Identities = 54/89 (60%), Positives = 71/89 (79%) Frame = -2 Query: 272 PDKAVETFHLMHKFSFSVEQKTYFVFLNILCTHGNIEEAEEFMFLNKKFFPLETESFNII 93 P KA+ F +M KF + +++ ++ LN+LC +GNIEEAEEFM +NKKFFPLE E FNII Sbjct: 106 PGKAIYAFRIMDKFRMTPDEEAFYFLLNVLCKNGNIEEAEEFMLVNKKFFPLEVEGFNII 165 Query: 92 LNGWCSVTVDINEAKRVWREMAKCCIEPD 6 LNGWC++ VD+ EAKR+WREM+K CI+PD Sbjct: 166 LNGWCNICVDVFEAKRIWREMSKYCIDPD 194