BLASTX nr result
ID: Scutellaria24_contig00003773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00003773 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285662.1| PREDICTED: metal tolerance protein 4 [Vitis ... 84 9e-15 ref|XP_004149018.1| PREDICTED: metal tolerance protein 4-like [C... 84 2e-14 gb|ADI24923.1| metal tolerance protein [Carica papaya] 82 4e-14 ref|XP_002531641.1| cation efflux protein/ zinc transporter, put... 82 6e-14 ref|XP_002299137.1| metal tolerance protein [Populus trichocarpa... 82 6e-14 >ref|XP_002285662.1| PREDICTED: metal tolerance protein 4 [Vitis vinifera] gi|297746418|emb|CBI16474.3| unnamed protein product [Vitis vinifera] Length = 416 Score = 84.3 bits (207), Expect = 9e-15 Identities = 36/44 (81%), Positives = 43/44 (97%) Frame = -3 Query: 502 TIGESLQMKLEKLPEVERAFVHLDYECEHKPEHSVLSRLPNSDP 371 TIGE+LQ+K+E+LPEVERAFVHLD+EC+HKPEHS+LSRLPNS P Sbjct: 373 TIGETLQIKIERLPEVERAFVHLDFECDHKPEHSILSRLPNSQP 416 >ref|XP_004149018.1| PREDICTED: metal tolerance protein 4-like [Cucumis sativus] gi|449527673|ref|XP_004170834.1| PREDICTED: metal tolerance protein 4-like [Cucumis sativus] gi|386783475|gb|AFJ24703.1| metal transport protein 8 [Cucumis sativus] Length = 408 Score = 83.6 bits (205), Expect = 2e-14 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 499 IGESLQMKLEKLPEVERAFVHLDYECEHKPEHSVLSRLPNSDP 371 IGE+LQ+K+EKLPEVERAFVHLD+ECEHKPEHS+LSRLPN+ P Sbjct: 366 IGETLQIKIEKLPEVERAFVHLDFECEHKPEHSILSRLPNTQP 408 >gb|ADI24923.1| metal tolerance protein [Carica papaya] Length = 408 Score = 82.0 bits (201), Expect = 4e-14 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -3 Query: 502 TIGESLQMKLEKLPEVERAFVHLDYECEHKPEHSVLSRLPNS 377 TIGESLQ+KLEKLPEVERAFVHLDYEC+HKPEHSVL+ LPN+ Sbjct: 365 TIGESLQIKLEKLPEVERAFVHLDYECDHKPEHSVLNSLPNN 406 >ref|XP_002531641.1| cation efflux protein/ zinc transporter, putative [Ricinus communis] gi|223528726|gb|EEF30737.1| cation efflux protein/ zinc transporter, putative [Ricinus communis] Length = 405 Score = 81.6 bits (200), Expect = 6e-14 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = -3 Query: 502 TIGESLQMKLEKLPEVERAFVHLDYECEHKPEHSVLSRLPNSD 374 TIGE+LQ K+EKLPEVERAFVHLD+ECEHKPEHS+LSRLPN++ Sbjct: 363 TIGETLQDKIEKLPEVERAFVHLDFECEHKPEHSILSRLPNNN 405 >ref|XP_002299137.1| metal tolerance protein [Populus trichocarpa] gi|222846395|gb|EEE83942.1| metal tolerance protein [Populus trichocarpa] Length = 393 Score = 81.6 bits (200), Expect = 6e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = -3 Query: 502 TIGESLQMKLEKLPEVERAFVHLDYECEHKPEHSVLSRLPN 380 TIGE+LQ K+EKLPEVERAFVHLD+ECEHKPEHSVLSRLPN Sbjct: 353 TIGETLQNKIEKLPEVERAFVHLDFECEHKPEHSVLSRLPN 393