BLASTX nr result
ID: Scutellaria24_contig00003750
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00003750 (333 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301250.1| predicted protein [Populus trichocarpa] gi|2... 90 6e-25 ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like is... 91 1e-24 ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-like [V... 89 5e-24 ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus com... 89 5e-24 emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] 89 5e-24 >ref|XP_002301250.1| predicted protein [Populus trichocarpa] gi|224137010|ref|XP_002327000.1| predicted protein [Populus trichocarpa] gi|222835315|gb|EEE73750.1| predicted protein [Populus trichocarpa] gi|222842976|gb|EEE80523.1| predicted protein [Populus trichocarpa] Length = 204 Score = 90.1 bits (222), Expect(2) = 6e-25 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 DPRINWIANPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 126 DPRINWI NPVHKHRELRGLTSAGKKYRGLRG+GHL+HKARP Sbjct: 145 DPRINWICNPVHKHRELRGLTSAGKKYRGLRGRGHLHHKARP 186 Score = 48.9 bits (115), Expect(2) = 6e-25 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = +2 Query: 212 KARPSRRATWKRNQTLSLRRYR 277 KARPSRRATWKRNQTLSLRRYR Sbjct: 183 KARPSRRATWKRNQTLSLRRYR 204 >ref|XP_004146916.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449458363|ref|XP_004146917.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] gi|449520285|ref|XP_004167164.1| PREDICTED: 60S ribosomal protein L15-like isoform 1 [Cucumis sativus] gi|449520287|ref|XP_004167165.1| PREDICTED: 60S ribosomal protein L15-like isoform 2 [Cucumis sativus] Length = 204 Score = 91.3 bits (225), Expect(2) = 1e-24 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 1 DPRINWIANPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 126 DPRINWI NPVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 145 DPRINWICNPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 47.0 bits (110), Expect(2) = 1e-24 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 212 KARPSRRATWKRNQTLSLRRYR 277 KARPSRRATWKRN TLSLRRYR Sbjct: 183 KARPSRRATWKRNNTLSLRRYR 204 >ref|XP_002268465.1| PREDICTED: 60S ribosomal protein L15-like [Vitis vinifera] Length = 204 Score = 89.0 bits (219), Expect(2) = 5e-24 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 DPRINWIANPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 126 DPRINWI PVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 145 DPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 47.0 bits (110), Expect(2) = 5e-24 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 212 KARPSRRATWKRNQTLSLRRYR 277 KARPSRRATWKRN TLSLRRYR Sbjct: 183 KARPSRRATWKRNNTLSLRRYR 204 >ref|XP_002510977.1| ribosomal protein L15, putative [Ricinus communis] gi|223550092|gb|EEF51579.1| ribosomal protein L15, putative [Ricinus communis] Length = 204 Score = 89.0 bits (219), Expect(2) = 5e-24 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 DPRINWIANPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 126 DPRINWI PVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 145 DPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 47.0 bits (110), Expect(2) = 5e-24 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 212 KARPSRRATWKRNQTLSLRRYR 277 KARPSRRATWKRN TLSLRRYR Sbjct: 183 KARPSRRATWKRNNTLSLRRYR 204 >emb|CAN68893.1| hypothetical protein VITISV_004609 [Vitis vinifera] Length = 204 Score = 89.0 bits (219), Expect(2) = 5e-24 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 1 DPRINWIANPVHKHRELRGLTSAGKKYRGLRGKGHLNHKARP 126 DPRINWI PVHKHRELRGLTSAGKKYRGLRGKGHL+HKARP Sbjct: 145 DPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARP 186 Score = 47.0 bits (110), Expect(2) = 5e-24 Identities = 21/22 (95%), Positives = 21/22 (95%) Frame = +2 Query: 212 KARPSRRATWKRNQTLSLRRYR 277 KARPSRRATWKRN TLSLRRYR Sbjct: 183 KARPSRRATWKRNNTLSLRRYR 204