BLASTX nr result
ID: Scutellaria24_contig00003645
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00003645 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515833.1| nucleic acid binding protein, putative [Rici... 76 3e-12 ref|XP_002317797.1| predicted protein [Populus trichocarpa] gi|2... 74 1e-11 ref|XP_002275189.2| PREDICTED: uncharacterized protein LOC100265... 73 2e-11 emb|CBI23047.3| unnamed protein product [Vitis vinifera] 73 2e-11 gb|AFY26894.1| RNA-binding protein with multiple splicing [Morel... 72 4e-11 >ref|XP_002515833.1| nucleic acid binding protein, putative [Ricinus communis] gi|223545062|gb|EEF46575.1| nucleic acid binding protein, putative [Ricinus communis] Length = 232 Score = 75.9 bits (185), Expect = 3e-12 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -2 Query: 482 GYKFDEHDRDSAHLRLQFARYPGARSGGGHRGKR 381 GYKFDEHDRDS HLRLQFARYPGARSGGGHRGKR Sbjct: 199 GYKFDEHDRDSVHLRLQFARYPGARSGGGHRGKR 232 >ref|XP_002317797.1| predicted protein [Populus trichocarpa] gi|222858470|gb|EEE96017.1| predicted protein [Populus trichocarpa] Length = 233 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 482 GYKFDEHDRDSAHLRLQFARYPGARSGGGHRGKR 381 GY+FDEHDRDS HLRLQFARYPGARSGGGHRGKR Sbjct: 200 GYRFDEHDRDSFHLRLQFARYPGARSGGGHRGKR 233 >ref|XP_002275189.2| PREDICTED: uncharacterized protein LOC100265772 [Vitis vinifera] Length = 229 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 482 GYKFDEHDRDSAHLRLQFARYPGARSGGGHRGKR 381 GYKFDEHDRDS +LRLQFARYPGARSGGGHRGKR Sbjct: 196 GYKFDEHDRDSVNLRLQFARYPGARSGGGHRGKR 229 >emb|CBI23047.3| unnamed protein product [Vitis vinifera] Length = 230 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -2 Query: 482 GYKFDEHDRDSAHLRLQFARYPGARSGGGHRGKR 381 GYKFDEHDRDS +LRLQFARYPGARSGGGHRGKR Sbjct: 197 GYKFDEHDRDSVNLRLQFARYPGARSGGGHRGKR 230 >gb|AFY26894.1| RNA-binding protein with multiple splicing [Morella rubra] Length = 233 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -2 Query: 482 GYKFDEHDRDSAHLRLQFARYPGARSGGGHRGKR 381 GYKFDEHDRDS LRLQFARYPGARSGGGHRGKR Sbjct: 200 GYKFDEHDRDSVSLRLQFARYPGARSGGGHRGKR 233