BLASTX nr result
ID: Scutellaria24_contig00003566
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00003566 (547 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510707.1| conserved hypothetical protein [Ricinus comm... 59 6e-07 >ref|XP_002510707.1| conserved hypothetical protein [Ricinus communis] gi|223551408|gb|EEF52894.1| conserved hypothetical protein [Ricinus communis] Length = 166 Score = 58.5 bits (140), Expect = 6e-07 Identities = 40/95 (42%), Positives = 54/95 (56%), Gaps = 4/95 (4%) Frame = -2 Query: 273 MTALSNSVVISQT--SAINLSSGSSLKSADQWVRPTNLAFSFK--GTKRSSTGRRAVTVR 106 MTA+SNS+ +++ + LS+GS KS Q V PT L+FS G + +T RR++TVR Sbjct: 1 MTAISNSLALTRNPVGTVQLSAGSLGKSL-QNVGPTKLSFSLNSPGKVQLTTSRRSLTVR 59 Query: 105 ASYSDGRPSNASXXXXXXXXXXXXXXXXGCVYAPQ 1 A+ DGRPS+ S GCVYAPQ Sbjct: 60 AASDDGRPSSGSIFVGGFVLGGLIVGALGCVYAPQ 94