BLASTX nr result
ID: Scutellaria24_contig00002907
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00002907 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containi... 95 5e-18 ref|XP_004167767.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 95 7e-18 ref|XP_004142106.1| PREDICTED: pentatricopeptide repeat-containi... 95 7e-18 ref|XP_003554352.1| PREDICTED: pentatricopeptide repeat-containi... 92 3e-17 ref|XP_002525196.1| pentatricopeptide repeat-containing protein,... 91 7e-17 >ref|XP_002273255.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic [Vitis vinifera] gi|297741486|emb|CBI32618.3| unnamed protein product [Vitis vinifera] Length = 842 Score = 95.1 bits (235), Expect = 5e-18 Identities = 45/62 (72%), Positives = 54/62 (87%) Frame = +1 Query: 55 QKLGVTADITSRNILLKSCCLASKVELAQDIYEEIRELESKGELKLDVFTYSTIVKVFAD 234 Q LGVTAD+ S NILLK+CC+A +V+LAQ+IY E++ LES G LKLDVFTYSTI+KVFAD Sbjct: 305 QNLGVTADMASYNILLKACCVAGRVDLAQEIYREVQNLESNGMLKLDVFTYSTIIKVFAD 364 Query: 235 AK 240 AK Sbjct: 365 AK 366 >ref|XP_004167767.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Cucumis sativus] Length = 855 Score = 94.7 bits (234), Expect = 7e-18 Identities = 46/62 (74%), Positives = 53/62 (85%) Frame = +1 Query: 55 QKLGVTADITSRNILLKSCCLASKVELAQDIYEEIRELESKGELKLDVFTYSTIVKVFAD 234 Q LGV AD+ S NILLK+CCLA +V+LAQDIY E++ LE+ G LKLDVFTYSTIVKVFAD Sbjct: 321 QNLGVPADMASYNILLKACCLAGRVDLAQDIYREVKHLETTGVLKLDVFTYSTIVKVFAD 380 Query: 235 AK 240 AK Sbjct: 381 AK 382 >ref|XP_004142106.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Cucumis sativus] Length = 849 Score = 94.7 bits (234), Expect = 7e-18 Identities = 46/62 (74%), Positives = 53/62 (85%) Frame = +1 Query: 55 QKLGVTADITSRNILLKSCCLASKVELAQDIYEEIRELESKGELKLDVFTYSTIVKVFAD 234 Q LGV AD+ S NILLK+CCLA +V+LAQDIY E++ LE+ G LKLDVFTYSTIVKVFAD Sbjct: 321 QNLGVPADMASYNILLKACCLAGRVDLAQDIYREVKHLETTGVLKLDVFTYSTIVKVFAD 380 Query: 235 AK 240 AK Sbjct: 381 AK 382 >ref|XP_003554352.1| PREDICTED: pentatricopeptide repeat-containing protein At5g02830, chloroplastic-like [Glycine max] Length = 811 Score = 92.4 bits (228), Expect = 3e-17 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +1 Query: 55 QKLGVTADITSRNILLKSCCLASKVELAQDIYEEIRELESKGELKLDVFTYSTIVKVFAD 234 Q LG+ D+TS NILLK+CC+A +V+LAQDIY E++ LES G+LKLDVFTYSTI+KVFAD Sbjct: 287 QNLGLKPDMTSYNILLKACCVAGRVDLAQDIYRELKHLESVGQLKLDVFTYSTIIKVFAD 346 Query: 235 AK 240 K Sbjct: 347 VK 348 >ref|XP_002525196.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535493|gb|EEF37162.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 786 Score = 91.3 bits (225), Expect = 7e-17 Identities = 46/69 (66%), Positives = 54/69 (78%) Frame = +1 Query: 34 IHSNECFQKLGVTADITSRNILLKSCCLASKVELAQDIYEEIRELESKGELKLDVFTYST 213 +H + Q LGVTAD+TS NILLKSC LA KV+LAQDIY E ++LE G LKLD FTY T Sbjct: 242 LHVYKKMQNLGVTADMTSYNILLKSCSLAGKVDLAQDIYREAKQLELAGLLKLDDFTYCT 301 Query: 214 IVKVFADAK 240 I+K+FADAK Sbjct: 302 IIKIFADAK 310