BLASTX nr result
ID: Scutellaria24_contig00002375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00002375 (731 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] 122 8e-26 gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays... 122 8e-26 ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 122 8e-26 ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 122 8e-26 ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helica... 122 8e-26 >gb|AFW81346.1| hypothetical protein ZEAMMB73_015937 [Zea mays] Length = 344 Score = 122 bits (306), Expect = 8e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 729 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTAT 550 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+T Sbjct: 281 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTST 340 Query: 549 Y 547 Y Sbjct: 341 Y 341 >gb|AFW81342.1| spliceosome RNA helicase BAT1 isoform 1 [Zea mays] gi|413948694|gb|AFW81343.1| spliceosome RNA helicase BAT1 isoform 2 [Zea mays] gi|413948695|gb|AFW81344.1| spliceosome RNA helicase BAT1 isoform 3 [Zea mays] Length = 429 Score = 122 bits (306), Expect = 8e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 729 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTAT 550 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+T Sbjct: 366 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTST 425 Query: 549 Y 547 Y Sbjct: 426 Y 426 >ref|XP_003569187.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 122 bits (306), Expect = 8e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 729 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTAT 550 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+T Sbjct: 365 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTST 424 Query: 549 Y 547 Y Sbjct: 425 Y 425 >ref|XP_003569186.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 429 Score = 122 bits (306), Expect = 8e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 729 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTAT 550 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+T Sbjct: 366 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTST 425 Query: 549 Y 547 Y Sbjct: 426 Y 426 >ref|XP_003569181.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 56-like [Brachypodium distachyon] Length = 428 Score = 122 bits (306), Expect = 8e-26 Identities = 60/61 (98%), Positives = 61/61 (100%) Frame = -3 Query: 729 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTAT 550 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDT+T Sbjct: 365 DMPDSADTYLHRVGRAGRFGTKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTST 424 Query: 549 Y 547 Y Sbjct: 425 Y 425