BLASTX nr result
ID: Scutellaria24_contig00002294
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00002294 (688 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509639.1| conserved hypothetical protein [Ricinus comm... 82 8e-14 ref|XP_002281385.1| PREDICTED: uncharacterized protein LOC100241... 79 6e-13 ref|XP_002303541.1| predicted protein [Populus trichocarpa] gi|2... 67 3e-09 ref|XP_003534604.1| PREDICTED: uncharacterized protein LOC100788... 65 1e-08 ref|XP_002299583.1| predicted protein [Populus trichocarpa] gi|2... 64 2e-08 >ref|XP_002509639.1| conserved hypothetical protein [Ricinus communis] gi|223549538|gb|EEF51026.1| conserved hypothetical protein [Ricinus communis] Length = 108 Score = 82.4 bits (202), Expect = 8e-14 Identities = 46/71 (64%), Positives = 56/71 (78%) Frame = +3 Query: 138 KSKRTKLRFLVRLSRRNKQEREKVGSDIVLKNLKLYMTNMSIKEENDKLRKKACLLHQEN 317 +SK+ K++ L L+RR QE E G D+ LKNLKLY+ N SI EEN+KLRKKA LLHQEN Sbjct: 22 RSKKPKVQVL-GLTRRRCQEEE--GKDMELKNLKLYLENQSIVEENEKLRKKANLLHQEN 78 Query: 318 LALISEFQRRF 350 LALISEFQ++F Sbjct: 79 LALISEFQKKF 89 >ref|XP_002281385.1| PREDICTED: uncharacterized protein LOC100241009 [Vitis vinifera] gi|297742657|emb|CBI34806.3| unnamed protein product [Vitis vinifera] Length = 99 Score = 79.3 bits (194), Expect = 6e-13 Identities = 43/72 (59%), Positives = 58/72 (80%) Frame = +3 Query: 135 PKSKRTKLRFLVRLSRRNKQEREKVGSDIVLKNLKLYMTNMSIKEENDKLRKKACLLHQE 314 P++KR+K++ + RL+RR + E + V D+ LKNLKLY+ N +I EEN+KLRKKA LLHQE Sbjct: 13 PRTKRSKVQ-VHRLTRRRRCEVQ-VEKDMELKNLKLYLENRNIMEENEKLRKKATLLHQE 70 Query: 315 NLALISEFQRRF 350 NLAL+SEFQ +F Sbjct: 71 NLALMSEFQTKF 82 >ref|XP_002303541.1| predicted protein [Populus trichocarpa] gi|222840973|gb|EEE78520.1| predicted protein [Populus trichocarpa] Length = 60 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +3 Query: 225 LKNLKLYMTNMSIKEENDKLRKKACLLHQENLALISEFQRRF 350 LKNLKLY+ N SI EEN+KLRKKA LLHQENLAL+SE Q++F Sbjct: 3 LKNLKLYLENQSIVEENEKLRKKASLLHQENLALMSELQKKF 44 >ref|XP_003534604.1| PREDICTED: uncharacterized protein LOC100788403 [Glycine max] Length = 111 Score = 65.1 bits (157), Expect = 1e-08 Identities = 35/80 (43%), Positives = 52/80 (65%), Gaps = 5/80 (6%) Frame = +3 Query: 132 HPKSKRTKLRFLVRLSRRNKQEREK-----VGSDIVLKNLKLYMTNMSIKEENDKLRKKA 296 H + +L L R K+ R++ V S+I +KNLKLYM N +I EEN+KLRK+A Sbjct: 24 HHNHRHLRLGMLNRRRAHLKEARQRKRIVVVKSEIQMKNLKLYMENQTIIEENEKLRKQA 83 Query: 297 CLLHQENLALISEFQRRFNK 356 LLH+EN AL+S+ Q++ ++ Sbjct: 84 MLLHKENQALLSQLQKKLSE 103 >ref|XP_002299583.1| predicted protein [Populus trichocarpa] gi|222846841|gb|EEE84388.1| predicted protein [Populus trichocarpa] Length = 68 Score = 64.3 bits (155), Expect = 2e-08 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = +3 Query: 210 GSDIVLKNLKLYMTNMSIKEENDKLRKKACLLHQENLALISEFQRRF 350 G D+ LKNLKL + N I EEN+KLRKKA LL QENLAL+SEFQ++F Sbjct: 3 GKDMELKNLKLCLENQRIVEENEKLRKKANLLRQENLALMSEFQKKF 49