BLASTX nr result
ID: Scutellaria24_contig00001718
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00001718 (784 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACF06529.1| cinnamyl alcohol dehydrogenase [Elaeis guineensis] 97 4e-18 ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-re... 93 7e-17 ref|XP_002517777.1| cinnamoyl-CoA reductase, putative [Ricinus c... 93 7e-17 ref|XP_002263014.1| PREDICTED: dihydroflavonol-4-reductase [Viti... 93 7e-17 ref|XP_003633518.1| PREDICTED: bifunctional dihydroflavonol 4-re... 91 2e-16 >gb|ACF06529.1| cinnamyl alcohol dehydrogenase [Elaeis guineensis] Length = 323 Score = 97.1 bits (240), Expect = 4e-18 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -2 Query: 174 MSGAEKVVCVTGGSGYVASWLVKVLLERGYTVKATVRDLSDPLKVAHLRALEGAEERL 1 MSG+ KVVCVTG SGY+ASWLVK+LL+RGYTV+A+VRDL+DP K+ HLRALEGA ERL Sbjct: 1 MSGSGKVVCVTGASGYIASWLVKLLLQRGYTVRASVRDLADPKKIEHLRALEGANERL 58 >ref|XP_003633515.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase-like [Vitis vinifera] gi|296085368|emb|CBI29100.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 92.8 bits (229), Expect = 7e-17 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -2 Query: 174 MSGAEKVVCVTGGSGYVASWLVKVLLERGYTVKATVRDLSDPLKVAHLRALEGAEERL 1 MSG KVVCVTG SGY+ASWLVK+LL+RGYTVKATVRD +DP K HL ALEGA+ERL Sbjct: 1 MSGQGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERL 58 >ref|XP_002517777.1| cinnamoyl-CoA reductase, putative [Ricinus communis] gi|223543049|gb|EEF44584.1| cinnamoyl-CoA reductase, putative [Ricinus communis] Length = 249 Score = 92.8 bits (229), Expect = 7e-17 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -2 Query: 174 MSGAEKVVCVTGGSGYVASWLVKVLLERGYTVKATVRDLSDPLKVAHLRALEGAEERL 1 MSG KVVCVTGGSGY+ASWL++ LL+RGYTVKATVRD +DP K AHL LEGA+ERL Sbjct: 1 MSGEGKVVCVTGGSGYIASWLIEFLLQRGYTVKATVRDPNDPKKTAHLLVLEGAKERL 58 >ref|XP_002263014.1| PREDICTED: dihydroflavonol-4-reductase [Vitis vinifera] gi|296086795|emb|CBI32944.3| unnamed protein product [Vitis vinifera] Length = 324 Score = 92.8 bits (229), Expect = 7e-17 Identities = 44/58 (75%), Positives = 50/58 (86%) Frame = -2 Query: 174 MSGAEKVVCVTGGSGYVASWLVKVLLERGYTVKATVRDLSDPLKVAHLRALEGAEERL 1 MSGAEKVVCVTG SGY+ASWLVK+LL+RGYTV A+VRD DP K HL AL+GA+ERL Sbjct: 1 MSGAEKVVCVTGASGYIASWLVKLLLQRGYTVNASVRDPDDPTKTEHLLALDGAKERL 58 >ref|XP_003633518.1| PREDICTED: bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase isoform 2 [Vitis vinifera] Length = 259 Score = 91.3 bits (225), Expect = 2e-16 Identities = 44/58 (75%), Positives = 49/58 (84%) Frame = -2 Query: 174 MSGAEKVVCVTGGSGYVASWLVKVLLERGYTVKATVRDLSDPLKVAHLRALEGAEERL 1 M G KVVCVTG SGY+ASWLVK+LL+RGYTVKATVRD +DP K HL ALEGA+ERL Sbjct: 1 MDGQGKVVCVTGASGYIASWLVKLLLQRGYTVKATVRDPNDPKKTEHLLALEGAKERL 58