BLASTX nr result
ID: Scutellaria24_contig00001677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00001677 (480 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG43518.1|AF210698_1 malonyl-CoA:ACP transacylase [Perilla f... 105 4e-21 gb|AFE88235.1| acyl-carrier-protein S-malonyltransferase [Nicoti... 71 8e-11 ref|NP_973564.2| [acyl-carrier-protein] S-malonyltransferase [Ar... 64 2e-08 ref|NP_565697.1| [acyl-carrier-protein] S-malonyltransferase [Ar... 64 2e-08 gb|AAM64515.1| putative malonyl-CoA:Acyl carrier protein transac... 64 2e-08 >gb|AAG43518.1|AF210698_1 malonyl-CoA:ACP transacylase [Perilla frutescens] Length = 376 Score = 105 bits (262), Expect = 4e-21 Identities = 56/74 (75%), Positives = 61/74 (82%), Gaps = 5/74 (6%) Frame = -1 Query: 411 LPSISLTKS-----ESFRSSCCFGFKNDIRRVSPWNLDKSRVSMSVAVRSEAVVVDDSLF 247 LPSISL+KS +SFRSS C GF+NDIRRVS N +KSRV MSVAV SEA VVDD+LF Sbjct: 7 LPSISLSKSAFADSDSFRSSVCLGFRNDIRRVSRLNFEKSRVFMSVAVGSEAAVVDDALF 66 Query: 246 KDYKPSTAFLFPGQ 205 KDYKPSTAFLFPGQ Sbjct: 67 KDYKPSTAFLFPGQ 80 >gb|AFE88235.1| acyl-carrier-protein S-malonyltransferase [Nicotiana tabacum] Length = 404 Score = 71.2 bits (173), Expect = 8e-11 Identities = 44/72 (61%), Positives = 48/72 (66%), Gaps = 2/72 (2%) Frame = -1 Query: 414 LLPSISLTKSE--SFRSSCCFGFKNDIRRVSPWNLDKSRVSMSVAVRSEAVVVDDSLFKD 241 LLPSISL S SS CF N IRR S +LDKSRV MSV+V S V DD+LF D Sbjct: 38 LLPSISLHNRAPLSLSSSNCFLSSNGIRRFSRIHLDKSRVFMSVSVGSRTAV-DDALFAD 96 Query: 240 YKPSTAFLFPGQ 205 YKP+ AFLFPGQ Sbjct: 97 YKPTNAFLFPGQ 108 >ref|NP_973564.2| [acyl-carrier-protein] S-malonyltransferase [Arabidopsis thaliana] gi|330253263|gb|AEC08357.1| [acyl-carrier-protein] S-malonyltransferase [Arabidopsis thaliana] Length = 369 Score = 63.5 bits (153), Expect = 2e-08 Identities = 36/70 (51%), Positives = 47/70 (67%) Frame = -1 Query: 414 LLPSISLTKSESFRSSCCFGFKNDIRRVSPWNLDKSRVSMSVAVRSEAVVVDDSLFKDYK 235 LLPSISL S +++ FGF + NL +SR+SMSV+ S++ V DSLF DYK Sbjct: 36 LLPSISLNNLSSSKNAS-FGF-------AAKNLSRSRISMSVSAGSQSTTVHDSLFADYK 87 Query: 234 PSTAFLFPGQ 205 P++AFLFPGQ Sbjct: 88 PTSAFLFPGQ 97 >ref|NP_565697.1| [acyl-carrier-protein] S-malonyltransferase [Arabidopsis thaliana] gi|20197098|gb|AAM14913.1| putative malonyl-CoA:Acyl carrier protein transacylase [Arabidopsis thaliana] gi|20258830|gb|AAM13897.1| putative malonyl-CoA:Acyl carrier protein transacylase [Arabidopsis thaliana] gi|21689721|gb|AAM67482.1| putative malonyl-CoA [Arabidopsis thaliana] gi|52354283|gb|AAU44462.1| hypothetical protein AT2G30200 [Arabidopsis thaliana] gi|60547729|gb|AAX23828.1| hypothetical protein At2g30200 [Arabidopsis thaliana] gi|330253262|gb|AEC08356.1| [acyl-carrier-protein] S-malonyltransferase [Arabidopsis thaliana] Length = 393 Score = 63.5 bits (153), Expect = 2e-08 Identities = 36/70 (51%), Positives = 47/70 (67%) Frame = -1 Query: 414 LLPSISLTKSESFRSSCCFGFKNDIRRVSPWNLDKSRVSMSVAVRSEAVVVDDSLFKDYK 235 LLPSISL S +++ FGF + NL +SR+SMSV+ S++ V DSLF DYK Sbjct: 36 LLPSISLNNLSSSKNAS-FGF-------AAKNLSRSRISMSVSAGSQSTTVHDSLFADYK 87 Query: 234 PSTAFLFPGQ 205 P++AFLFPGQ Sbjct: 88 PTSAFLFPGQ 97 >gb|AAM64515.1| putative malonyl-CoA:Acyl carrier protein transacylase [Arabidopsis thaliana] Length = 367 Score = 63.5 bits (153), Expect = 2e-08 Identities = 36/70 (51%), Positives = 47/70 (67%) Frame = -1 Query: 414 LLPSISLTKSESFRSSCCFGFKNDIRRVSPWNLDKSRVSMSVAVRSEAVVVDDSLFKDYK 235 LLPSISL S +++ FGF + NL +SR+SMSV+ S++ V DSLF DYK Sbjct: 10 LLPSISLNNLSSSKNAS-FGF-------AAKNLSRSRISMSVSAGSQSTTVHDSLFADYK 61 Query: 234 PSTAFLFPGQ 205 P++AFLFPGQ Sbjct: 62 PTSAFLFPGQ 71