BLASTX nr result
ID: Scutellaria24_contig00001562
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00001562 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta] 78 6e-13 emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta] 78 6e-13 ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein o... 78 8e-13 ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein o... 78 8e-13 ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3... 78 8e-13 >emb|CAA47950.1| chlorophyll a/b binding protein [Pinus contorta] Length = 274 Score = 78.2 bits (191), Expect = 6e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 3 QAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 110 QAIVTGKGP+ENLADHLADPVSNNAWAYATNFVPGK Sbjct: 239 QAIVTGKGPIENLADHLADPVSNNAWAYATNFVPGK 274 >emb|CAC38830.1| chlorophyll a/b binding protein [Pinus contorta] Length = 274 Score = 78.2 bits (191), Expect = 6e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 3 QAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 110 QAIVTGKGP+ENLADHLADPVSNNAWAYATNFVPGK Sbjct: 239 QAIVTGKGPIENLADHLADPVSNNAWAYATNFVPGK 274 >ref|XP_004170962.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 265 Score = 77.8 bits (190), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 3 QAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 110 QAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK Sbjct: 230 QAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265 >ref|XP_004155624.1| PREDICTED: chlorophyll a-b binding protein of LHCII type I, chloroplastic-like [Cucumis sativus] Length = 153 Score = 77.8 bits (190), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 3 QAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 110 QAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK Sbjct: 118 QAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 153 >ref|XP_004148579.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Cucumis sativus] gi|449518125|ref|XP_004166094.1| PREDICTED: chlorophyll a-b binding protein 3C, chloroplastic-like [Cucumis sativus] Length = 265 Score = 77.8 bits (190), Expect = 8e-13 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +3 Query: 3 QAIVTGKGPLENLADHLADPVSNNAWAYATNFVPGK 110 QAIVTGKGPLENLADHLADPV+NNAWAYATNFVPGK Sbjct: 230 QAIVTGKGPLENLADHLADPVNNNAWAYATNFVPGK 265