BLASTX nr result
ID: Scutellaria24_contig00000797
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00000797 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632613.1| PREDICTED: 31 kDa ribonucleoprotein, chlorop... 55 5e-06 ref|XP_002281642.1| PREDICTED: 31 kDa ribonucleoprotein, chlorop... 55 5e-06 >ref|XP_003632613.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic isoform 2 [Vitis vinifera] Length = 254 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = +2 Query: 107 ASRFVRNVAISSELDEEVEDEYSSQREPNFAPELKLFVGNLP 232 +SRFVRNVA+SS+ +++ ED S + EP+F+P+LKLFVGNLP Sbjct: 58 SSRFVRNVAVSSDYEQD-EDVLSDEGEPSFSPDLKLFVGNLP 98 >ref|XP_002281642.1| PREDICTED: 31 kDa ribonucleoprotein, chloroplastic isoform 1 [Vitis vinifera] Length = 288 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/42 (61%), Positives = 36/42 (85%) Frame = +2 Query: 107 ASRFVRNVAISSELDEEVEDEYSSQREPNFAPELKLFVGNLP 232 +SRFVRNVA+SS+ +++ ED S + EP+F+P+LKLFVGNLP Sbjct: 58 SSRFVRNVAVSSDYEQD-EDVLSDEGEPSFSPDLKLFVGNLP 98