BLASTX nr result
ID: Scutellaria24_contig00000140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00000140 (210 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004167703.1| PREDICTED: probable E3 ubiquitin-protein lig... 72 5e-11 ref|XP_004140878.1| PREDICTED: probable E3 ubiquitin-protein lig... 72 5e-11 ref|XP_004138892.1| PREDICTED: probable E3 ubiquitin-protein lig... 72 5e-11 ref|XP_002315117.1| predicted protein [Populus trichocarpa] gi|2... 71 8e-11 ref|XP_002312201.1| predicted protein [Populus trichocarpa] gi|2... 71 1e-10 >ref|XP_004167703.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI7-like [Cucumis sativus] Length = 327 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/56 (66%), Positives = 44/56 (78%) Frame = -1 Query: 168 SSNHFDYHHRSQNYTILNEDDIRQCQDESITQISTVLSISRVAAVILLRQYNWSVS 1 S + Y H+ QNY IL E DI+QCQ+E IT++STVLSIS+VAA ILLR YNWSVS Sbjct: 57 SDDMVSYRHQ-QNYIILAEADIQQCQEEDITRVSTVLSISKVAASILLRYYNWSVS 111 >ref|XP_004140878.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Cucumis sativus] Length = 591 Score = 72.0 bits (175), Expect = 5e-11 Identities = 32/56 (57%), Positives = 46/56 (82%) Frame = -1 Query: 168 SSNHFDYHHRSQNYTILNEDDIRQCQDESITQISTVLSISRVAAVILLRQYNWSVS 1 + ++F+ R QNYTILNE DIRQ Q++ I +IS+VLSISRVA+++LLR +NW+V+ Sbjct: 50 TDDYFEASRREQNYTILNESDIRQRQEDDIARISSVLSISRVASIVLLRHFNWNVT 105 >ref|XP_004138892.1| PREDICTED: probable E3 ubiquitin-protein ligase ARI8-like [Cucumis sativus] Length = 597 Score = 72.0 bits (175), Expect = 5e-11 Identities = 37/56 (66%), Positives = 44/56 (78%) Frame = -1 Query: 168 SSNHFDYHHRSQNYTILNEDDIRQCQDESITQISTVLSISRVAAVILLRQYNWSVS 1 S + Y H+ QNY IL E DI+QCQ+E IT++STVLSIS+VAA ILLR YNWSVS Sbjct: 57 SDDMVSYRHQ-QNYIILAEADIQQCQEEDITRVSTVLSISKVAASILLRYYNWSVS 111 >ref|XP_002315117.1| predicted protein [Populus trichocarpa] gi|222864157|gb|EEF01288.1| predicted protein [Populus trichocarpa] Length = 591 Score = 71.2 bits (173), Expect = 8e-11 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = -1 Query: 147 HHRSQNYTILNEDDIRQCQDESITQISTVLSISRVAAVILLRQYNWSVS 1 H QNYT+L+E+DIRQ QD+ + +I+TVLSIS+VAA ILLR YNWSVS Sbjct: 56 HRHQQNYTVLSEEDIRQRQDDDVMRIATVLSISKVAASILLRYYNWSVS 104 >ref|XP_002312201.1| predicted protein [Populus trichocarpa] gi|222852021|gb|EEE89568.1| predicted protein [Populus trichocarpa] Length = 591 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/49 (71%), Positives = 40/49 (81%) Frame = -1 Query: 147 HHRSQNYTILNEDDIRQCQDESITQISTVLSISRVAAVILLRQYNWSVS 1 H QNYTIL+E DIRQ QD+ I +I+TVLSIS+VAA ILLR YNWSVS Sbjct: 56 HRYQQNYTILSEGDIRQRQDDDIMRIATVLSISKVAATILLRYYNWSVS 104