BLASTX nr result
ID: Scutellaria24_contig00000066
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00000066 (563 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABV58319.1| metallothionein class I type 3 [Avicennia marina]... 78 9e-13 gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] 75 9e-12 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 73 3e-11 gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 70 2e-10 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 69 4e-10 >gb|ABV58319.1| metallothionein class I type 3 [Avicennia marina] gi|157497147|gb|ABV58320.1| metallothionein class I type 3 [Avicennia marina] Length = 61 Score = 78.2 bits (191), Expect = 9e-13 Identities = 34/52 (65%), Positives = 41/52 (78%), Gaps = 4/52 (7%) Frame = +1 Query: 106 DTTQCVKKGYAADIIETEKSYTVEALV----GGEHDGKCKCGTNCACTDCTC 249 D +QC+KKGYAA+IIETEKSY A++ EHDGKCKCG +CACT+CTC Sbjct: 8 DKSQCMKKGYAAEIIETEKSYMEAAMLVDAPAAEHDGKCKCGPSCACTNCTC 59 >gb|AEQ54919.1| metallothionin 3 [Salvia miltiorrhiza] Length = 63 Score = 74.7 bits (182), Expect = 9e-12 Identities = 32/50 (64%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = +1 Query: 106 DTTQCVKKGYAADIIETEKSYTV--EALVGGEHDGKCKCGTNCACTDCTC 249 D +QC K GY ADIIETEKSY + +A E+DGKCKCG++C+CTDCTC Sbjct: 12 DKSQCGKNGYTADIIETEKSYAMVMDAPAAAENDGKCKCGSSCSCTDCTC 61 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 73.2 bits (178), Expect = 3e-11 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 5/53 (9%) Frame = +1 Query: 106 DTTQCVKKG--YAADIIETEKSYTVEALVGGE---HDGKCKCGTNCACTDCTC 249 D +QCVKKG Y DI+ETEKSY E +V E HDGKCKCG CACTDC C Sbjct: 11 DKSQCVKKGNSYGIDIVETEKSYVDEVIVAAEAAEHDGKCKCGAACACTDCKC 63 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 70.5 bits (171), Expect = 2e-10 Identities = 32/53 (60%), Positives = 38/53 (71%), Gaps = 5/53 (9%) Frame = +1 Query: 106 DTTQCVKKG--YAADIIETEKSY---TVEALVGGEHDGKCKCGTNCACTDCTC 249 D +QCVKKG Y +IIETEKS+ TV + EHDGKCKCG++C C DCTC Sbjct: 11 DKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAAEHDGKCKCGSSCTCVDCTC 63 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489652|gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489720|gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 69.3 bits (168), Expect = 4e-10 Identities = 33/53 (62%), Positives = 37/53 (69%), Gaps = 5/53 (9%) Frame = +1 Query: 106 DTTQCVKKG--YAADIIETEKSYT---VEALVGGEHDGKCKCGTNCACTDCTC 249 D TQCVKKG Y ADI+ETEKS+ V + E+DGKCKCG NC CT CTC Sbjct: 12 DKTQCVKKGSSYTADIVETEKSHVSTGVMEVPATENDGKCKCGANCTCTTCTC 64