BLASTX nr result
ID: Scutellaria24_contig00000010
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria24_contig00000010 (571 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277315.1| PREDICTED: magnesium transporter NIPA2 [Viti... 82 6e-14 ref|XP_004144837.1| PREDICTED: magnesium transporter NIPA2-like ... 64 1e-08 ref|XP_003540795.1| PREDICTED: magnesium transporter NIPA2-like ... 62 9e-08 ref|XP_003523502.1| PREDICTED: magnesium transporter NIPA2-like ... 62 9e-08 gb|AFK48619.1| unknown [Medicago truncatula] 61 1e-07 >ref|XP_002277315.1| PREDICTED: magnesium transporter NIPA2 [Vitis vinifera] gi|297744652|emb|CBI37914.3| unnamed protein product [Vitis vinifera] Length = 334 Score = 82.0 bits (201), Expect = 6e-14 Identities = 38/54 (70%), Positives = 45/54 (83%), Gaps = 1/54 (1%) Frame = -2 Query: 570 CGFITVLSGTVILHATREEEPPNATGTIIWY-DEDPSKGLEEAHFITLNNSDYF 412 CGFITVLSGT+ILHATRE+EP A+GTI WY D KG+E+ HFITL++SDYF Sbjct: 279 CGFITVLSGTIILHATREQEPATASGTITWYLSGDAMKGVEDEHFITLHHSDYF 332 >ref|XP_004144837.1| PREDICTED: magnesium transporter NIPA2-like [Cucumis sativus] gi|449510408|ref|XP_004163655.1| PREDICTED: magnesium transporter NIPA2-like [Cucumis sativus] Length = 333 Score = 64.3 bits (155), Expect = 1e-08 Identities = 27/52 (51%), Positives = 38/52 (73%) Frame = -2 Query: 570 CGFITVLSGTVILHATREEEPPNATGTIIWYDEDPSKGLEEAHFITLNNSDY 415 CGF+TVLSGT+ILH+TRE++P ++ G++ WY S E H IT++NS Y Sbjct: 279 CGFVTVLSGTIILHSTREQQPVSSQGSVAWYISGDSMKSFEEHLITISNSHY 330 >ref|XP_003540795.1| PREDICTED: magnesium transporter NIPA2-like [Glycine max] Length = 337 Score = 61.6 bits (148), Expect = 9e-08 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -2 Query: 570 CGFITVLSGTVILHATREEEPPNATGTIIWY-DEDPSKGLEEAHFITLNNSDY 415 CGFITVL+GT+ILH TRE+E N T W+ ED KG+E H I +++SDY Sbjct: 282 CGFITVLTGTIILHMTREQEESNMQKTSTWFIGEDLMKGVENEHLIRIHDSDY 334 >ref|XP_003523502.1| PREDICTED: magnesium transporter NIPA2-like [Glycine max] Length = 334 Score = 61.6 bits (148), Expect = 9e-08 Identities = 28/53 (52%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -2 Query: 570 CGFITVLSGTVILHATREEEPPNATGTIIWY-DEDPSKGLEEAHFITLNNSDY 415 CGF+ VLSGT++LHATRE+E N G++ WY ED K +E+ H L+ SDY Sbjct: 279 CGFVIVLSGTILLHATREQEQSNKQGSLTWYIGEDLVKRIEDGHLNLLHGSDY 331 >gb|AFK48619.1| unknown [Medicago truncatula] Length = 85 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/52 (51%), Positives = 37/52 (71%), Gaps = 1/52 (1%) Frame = -2 Query: 570 CGFITVLSGTVILHATREEEPPNATGTIIWY-DEDPSKGLEEAHFITLNNSD 418 CGFITVL+GT+ILH T+E+E GT+ W+ ED +K +E+ H I +N SD Sbjct: 30 CGFITVLTGTIILHGTKEQEESTRKGTMSWFMSEDSTKCVEDEHLIVINGSD 81