BLASTX nr result
ID: Scutellaria23_contig00035875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035875 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002524030.1| pentatricopeptide repeat-containing protein,... 72 4e-11 ref|XP_003637381.1| Pentatricopeptide repeat-containing protein ... 72 5e-11 ref|XP_003637626.1| Pentatricopeptide repeat-containing protein ... 69 3e-10 ref|XP_003528450.1| PREDICTED: pentatricopeptide repeat-containi... 68 7e-10 tpg|DAA42637.1| TPA: hypothetical protein ZEAMMB73_021738 [Zea m... 61 1e-07 >ref|XP_002524030.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223536757|gb|EEF38398.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1016 Score = 72.4 bits (176), Expect = 4e-11 Identities = 36/77 (46%), Positives = 48/77 (62%) Frame = +2 Query: 2 SDMVKRGVDCDNFTCNILIKGYCEKGMLENARLVMDMMSSNVHGDGKVCRDVVGFNTLIS 181 S MVK+ D TCNIL+KG+C G+ + +MD + S G C+DV+GFNTLI Sbjct: 101 SIMVKKDTCFDTITCNILVKGFCRIGLAKYGERIMDNLVS-----GGTCKDVIGFNTLID 155 Query: 182 GYCKAGKVVGGLQLMGR 232 GYCKAG++ L L+ R Sbjct: 156 GYCKAGEMSLALDLVER 172 >ref|XP_003637381.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503316|gb|AES84519.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1023 Score = 72.0 bits (175), Expect = 5e-11 Identities = 36/75 (48%), Positives = 50/75 (66%) Frame = +2 Query: 2 SDMVKRGVDCDNFTCNILIKGYCEKGMLENARLVMDMMSSNVHGDGKVCRDVVGFNTLIS 181 S+MVKRG+ D+ TCNIL+KGYC G+++ A VM + DG V +DV+G NTLI Sbjct: 186 SEMVKRGLCFDSITCNILVKGYCRIGLVQYAEWVMYNLV-----DGGVTKDVIGLNTLID 240 Query: 182 GYCKAGKVVGGLQLM 226 GYC+AG + +L+ Sbjct: 241 GYCEAGLMSQATELI 255 >ref|XP_003637626.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503561|gb|AES84764.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 989 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/65 (52%), Positives = 45/65 (69%) Frame = +2 Query: 2 SDMVKRGVDCDNFTCNILIKGYCEKGMLENARLVMDMMSSNVHGDGKVCRDVVGFNTLIS 181 S+MVKRG+ D+ TCNIL+KGYC G+++ A VM + DG V +DV+G NTLI Sbjct: 186 SEMVKRGLCFDSITCNILVKGYCRIGLVQYAEWVMYNLV-----DGGVTKDVIGLNTLID 240 Query: 182 GYCKA 196 GYC+A Sbjct: 241 GYCEA 245 >ref|XP_003528450.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial-like [Glycine max] Length = 1012 Score = 68.2 bits (165), Expect = 7e-10 Identities = 35/75 (46%), Positives = 49/75 (65%) Frame = +2 Query: 2 SDMVKRGVDCDNFTCNILIKGYCEKGMLENARLVMDMMSSNVHGDGKVCRDVVGFNTLIS 181 S+MVK+GV D+ TCNIL+KGYC+ G+++ A +M N+ G G V D +G NTL+ Sbjct: 99 SEMVKKGVCFDSVTCNILVKGYCQIGLVQYAEWIM----GNLVGGG-VPLDAIGLNTLVD 153 Query: 182 GYCKAGKVVGGLQLM 226 GYC+ G V L L+ Sbjct: 154 GYCEVGLVSRALDLV 168 >tpg|DAA42637.1| TPA: hypothetical protein ZEAMMB73_021738 [Zea mays] Length = 768 Score = 60.8 bits (146), Expect = 1e-07 Identities = 32/75 (42%), Positives = 44/75 (58%) Frame = +2 Query: 8 MVKRGVDCDNFTCNILIKGYCEKGMLENARLVMDMMSSNVHGDGKVCRDVVGFNTLISGY 187 ++KRG+ + FTCNI I+G CE G LE A +++ M + V DVV +NTL+ G Sbjct: 237 VLKRGMSANKFTCNIWIRGLCEDGRLEEAVALVERMGA------YVAPDVVTYNTLMRGL 290 Query: 188 CKAGKVVGGLQLMGR 232 CK KV Q +GR Sbjct: 291 CKDSKVQEAAQYLGR 305