BLASTX nr result
ID: Scutellaria23_contig00035798
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035798 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002514568.1| conserved hypothetical protein [Ricinus comm... 127 1e-27 ref|XP_002267536.1| PREDICTED: uncharacterized protein LOC100253... 125 4e-27 ref|XP_002315994.1| predicted protein [Populus trichocarpa] gi|2... 122 4e-26 ref|XP_002311420.1| predicted protein [Populus trichocarpa] gi|2... 122 4e-26 ref|XP_004135422.1| PREDICTED: uncharacterized protein LOC101217... 118 4e-25 >ref|XP_002514568.1| conserved hypothetical protein [Ricinus communis] gi|223546172|gb|EEF47674.1| conserved hypothetical protein [Ricinus communis] Length = 444 Score = 127 bits (319), Expect = 1e-27 Identities = 61/80 (76%), Positives = 70/80 (87%) Frame = +1 Query: 19 MASFSIEEFVGNGSLKELLAKLVDEGWDDVPTLKVMNAEDMDDIGMTQKHKDALEIRSYL 198 MASFSIEEFVGNG+LK+LL KLV++GWDDVPTLK+MN+EDM+ + MT + KDALEIRSYL Sbjct: 1 MASFSIEEFVGNGALKKLLPKLVEDGWDDVPTLKIMNSEDMEAMNMTLRQKDALEIRSYL 60 Query: 199 HDRVLMIYGDILEASGKGLP 258 HDR LM YGD LE SGK LP Sbjct: 61 HDRALMQYGDKLEESGKSLP 80 >ref|XP_002267536.1| PREDICTED: uncharacterized protein LOC100253093 [Vitis vinifera] gi|297738213|emb|CBI27414.3| unnamed protein product [Vitis vinifera] Length = 417 Score = 125 bits (314), Expect = 4e-27 Identities = 60/80 (75%), Positives = 70/80 (87%) Frame = +1 Query: 19 MASFSIEEFVGNGSLKELLAKLVDEGWDDVPTLKVMNAEDMDDIGMTQKHKDALEIRSYL 198 MASFS+E+F+GNG+LK LL KLV+EGWDDVPTLK+MN+EDMD I MTQ+ K ALE+RSYL Sbjct: 1 MASFSMEDFIGNGALKGLLPKLVEEGWDDVPTLKIMNSEDMDAINMTQQQKAALELRSYL 60 Query: 199 HDRVLMIYGDILEASGKGLP 258 HDR LM YGD LE+SGK LP Sbjct: 61 HDRALMQYGDKLESSGKFLP 80 >ref|XP_002315994.1| predicted protein [Populus trichocarpa] gi|222865034|gb|EEF02165.1| predicted protein [Populus trichocarpa] Length = 406 Score = 122 bits (305), Expect = 4e-26 Identities = 57/80 (71%), Positives = 69/80 (86%) Frame = +1 Query: 19 MASFSIEEFVGNGSLKELLAKLVDEGWDDVPTLKVMNAEDMDDIGMTQKHKDALEIRSYL 198 MASFS+E+FVGNG LK+LL L++EGWDD+PTLK+MN+ED D + MT++ KDALEIRSYL Sbjct: 1 MASFSVEDFVGNGVLKDLLPTLLEEGWDDIPTLKIMNSEDTDAMNMTRQQKDALEIRSYL 60 Query: 199 HDRVLMIYGDILEASGKGLP 258 HDR L+ YGD LEASGK LP Sbjct: 61 HDRALLQYGDKLEASGKCLP 80 >ref|XP_002311420.1| predicted protein [Populus trichocarpa] gi|222851240|gb|EEE88787.1| predicted protein [Populus trichocarpa] Length = 415 Score = 122 bits (305), Expect = 4e-26 Identities = 59/80 (73%), Positives = 67/80 (83%) Frame = +1 Query: 19 MASFSIEEFVGNGSLKELLAKLVDEGWDDVPTLKVMNAEDMDDIGMTQKHKDALEIRSYL 198 MASFS+E+FVGNG LK+LL L+ EGWDDVPTLK+MN ED D + MTQ+ KDALEIRSYL Sbjct: 1 MASFSVEDFVGNGVLKDLLPTLLKEGWDDVPTLKIMNKEDTDAMNMTQQQKDALEIRSYL 60 Query: 199 HDRVLMIYGDILEASGKGLP 258 HDR L+ YGD LEASGK LP Sbjct: 61 HDRALLQYGDKLEASGKCLP 80 >ref|XP_004135422.1| PREDICTED: uncharacterized protein LOC101217484 [Cucumis sativus] gi|449493522|ref|XP_004159330.1| PREDICTED: uncharacterized protein LOC101230345 [Cucumis sativus] Length = 413 Score = 118 bits (296), Expect = 4e-25 Identities = 56/80 (70%), Positives = 68/80 (85%) Frame = +1 Query: 19 MASFSIEEFVGNGSLKELLAKLVDEGWDDVPTLKVMNAEDMDDIGMTQKHKDALEIRSYL 198 M SFS+E+FVGNG LK+LL L+DEGWDDVPTLKVMN+EDMD I MT++ K+A+EIR+YL Sbjct: 1 MGSFSVEDFVGNGVLKDLLPTLLDEGWDDVPTLKVMNSEDMDAINMTRQQKEAIEIRTYL 60 Query: 199 HDRVLMIYGDILEASGKGLP 258 HDR LM Y D LE++GK LP Sbjct: 61 HDRSLMPYADRLESTGKCLP 80