BLASTX nr result
ID: Scutellaria23_contig00035721
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035721 (247 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containi... 106 2e-21 ref|XP_002302000.1| predicted protein [Populus trichocarpa] gi|2... 105 5e-21 emb|CBI19832.3| unnamed protein product [Vitis vinifera] 104 6e-21 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 104 6e-21 ref|XP_004157956.1| PREDICTED: pentatricopeptide repeat-containi... 100 2e-19 >ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] gi|449504088|ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 106 bits (264), Expect = 2e-21 Identities = 44/51 (86%), Positives = 48/51 (94%) Frame = +3 Query: 3 TIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGKRFHHFKDGECSCGNYW 155 T+R+FKNLRICGDCHNAIKFMSK GREI+VRDGKRFHHFK+GECSC NYW Sbjct: 747 TVRVFKNLRICGDCHNAIKFMSKVVGREIVVRDGKRFHHFKNGECSCRNYW 797 >ref|XP_002302000.1| predicted protein [Populus trichocarpa] gi|222843726|gb|EEE81273.1| predicted protein [Populus trichocarpa] Length = 797 Score = 105 bits (261), Expect = 5e-21 Identities = 42/51 (82%), Positives = 48/51 (94%) Frame = +3 Query: 3 TIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGKRFHHFKDGECSCGNYW 155 T+R+FKNLRICGDCHNA KFMSK GREI+VRDGKRFHHF+DG+CSCG+YW Sbjct: 747 TVRVFKNLRICGDCHNAFKFMSKVVGREIVVRDGKRFHHFRDGKCSCGDYW 797 >emb|CBI19832.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 104 bits (260), Expect = 6e-21 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +3 Query: 3 TIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGKRFHHFKDGECSCGNYW 155 T+R+FKNLRICGDCHNA KFMSK REI+VRDGKRFHHFK+GECSCGNYW Sbjct: 494 TVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 544 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 104 bits (260), Expect = 6e-21 Identities = 43/51 (84%), Positives = 47/51 (92%) Frame = +3 Query: 3 TIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGKRFHHFKDGECSCGNYW 155 T+R+FKNLRICGDCHNA KFMSK REI+VRDGKRFHHFK+GECSCGNYW Sbjct: 749 TVRVFKNLRICGDCHNAFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 799 >ref|XP_004157956.1| PREDICTED: pentatricopeptide repeat-containing protein At2g15690-like [Cucumis sativus] Length = 458 Score = 100 bits (248), Expect = 2e-19 Identities = 42/51 (82%), Positives = 46/51 (90%) Frame = +3 Query: 3 TIRIFKNLRICGDCHNAIKFMSKAEGREIIVRDGKRFHHFKDGECSCGNYW 155 T+RI KNLRICGDCHNAIK MSK GRE+IVRD KRFHHFKDG+CSCG+YW Sbjct: 408 TLRIIKNLRICGDCHNAIKIMSKIVGRELIVRDNKRFHHFKDGKCSCGDYW 458