BLASTX nr result
ID: Scutellaria23_contig00035530
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035530 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001241356.1| dehydration-responsive element-binding prote... 63 2e-08 gb|ACU23160.1| unknown [Glycine max] 63 2e-08 ref|NP_001239694.1| dehydration-responsive element-binding prote... 61 8e-08 gb|ADE41141.1| AP2 domain class transcription factor [Malus x do... 59 4e-07 gb|ADE41102.1| AP2 domain class transcription factor [Malus x do... 59 4e-07 >ref|NP_001241356.1| dehydration-responsive element-binding protein 3-like [Glycine max] gi|212717188|gb|ACJ37435.1| AP2 domain-containing transcription factor 1 [Glycine max] Length = 194 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 228 KKIKRIRCDDGSGSTTKHPVYRGVRMRNWGKWVSEI 335 KKIKRIR G S+ KHP+YRGVRMRNWGKWVSEI Sbjct: 15 KKIKRIRGGGGGDSSNKHPLYRGVRMRNWGKWVSEI 50 >gb|ACU23160.1| unknown [Glycine max] Length = 194 Score = 63.2 bits (152), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = +3 Query: 228 KKIKRIRCDDGSGSTTKHPVYRGVRMRNWGKWVSEI 335 KKIKRIR G S+ KHP+YRGVRMRNWGKWVSEI Sbjct: 15 KKIKRIRGGGGGDSSNKHPLYRGVRMRNWGKWVSEI 50 >ref|NP_001239694.1| dehydration-responsive element-binding protein 3-like [Glycine max] gi|212717190|gb|ACJ37436.1| AP2 domain-containing transcription factor 2 [Glycine max] Length = 188 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = +3 Query: 228 KKIKRIRCDDGSGSTTKHPVYRGVRMRNWGKWVSEI 335 KKIKRIR G G ++KHP+YRGVRMRNWGKWVSEI Sbjct: 12 KKIKRIR---GGGDSSKHPLYRGVRMRNWGKWVSEI 44 >gb|ADE41141.1| AP2 domain class transcription factor [Malus x domestica] Length = 243 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +3 Query: 234 IKRIRCDDGSGSTTKHPVYRGVRMRNWGKWVSEI 335 +KR R DD + +++KHPVYRGVRMRNWGKWVSEI Sbjct: 52 LKRKRHDDSNVNSSKHPVYRGVRMRNWGKWVSEI 85 >gb|ADE41102.1| AP2 domain class transcription factor [Malus x domestica] Length = 241 Score = 58.9 bits (141), Expect = 4e-07 Identities = 30/68 (44%), Positives = 40/68 (58%), Gaps = 2/68 (2%) Frame = +3 Query: 138 SNCDSIVMNTDQNHTXXXXXXXXXXXXXXGKKI--KRIRCDDGSGSTTKHPVYRGVRMRN 311 S+C S ++ T N T +++ KR R DD + +++KHPVYRGVR RN Sbjct: 17 SSCSSGLLQTRPNSTANTLNTKTKKPSREQQQVVLKRKRDDDSNNNSSKHPVYRGVRKRN 76 Query: 312 WGKWVSEI 335 WGKWVSEI Sbjct: 77 WGKWVSEI 84