BLASTX nr result
ID: Scutellaria23_contig00035526
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035526 (354 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003631143.1| Purple acid phosphatase [Medicago truncatula... 71 2e-19 ref|XP_003631144.1| Purple acid phosphatase [Medicago truncatula... 71 2e-19 gb|AAF60317.1|AF236109_1 putative purple acid phosphatase precur... 70 6e-18 ref|NP_001241371.1| uncharacterized protein LOC100817359 precurs... 67 8e-18 emb|CAE85073.1| putative acid phosphatase [Lupinus luteus] 64 9e-16 >ref|XP_003631143.1| Purple acid phosphatase [Medicago truncatula] gi|355525165|gb|AET05619.1| Purple acid phosphatase [Medicago truncatula] Length = 341 Score = 70.9 bits (172), Expect(2) = 2e-19 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +3 Query: 207 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSNH 344 DL TAL+ S A WKIVVGHHP+RSIG GDT ELL H+LPIL +N+ Sbjct: 206 DLETALRDSTAKWKIVVGHHPVRSIGHHGDTKELLTHLLPILEANN 251 Score = 49.7 bits (117), Expect(2) = 2e-19 Identities = 21/32 (65%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +2 Query: 2 FIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 94 F+DT PFVDKYF K + +K++W+GVLPR KYL Sbjct: 169 FVDTTPFVDKYFLKPKDHKYDWRGVLPRKKYL 200 >ref|XP_003631144.1| Purple acid phosphatase [Medicago truncatula] gi|355525166|gb|AET05620.1| Purple acid phosphatase [Medicago truncatula] Length = 300 Score = 70.9 bits (172), Expect(2) = 2e-19 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = +3 Query: 207 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSNH 344 DL TAL+ S A WKIVVGHHP+RSIG GDT ELL H+LPIL +N+ Sbjct: 165 DLETALRDSTAKWKIVVGHHPVRSIGHHGDTKELLTHLLPILEANN 210 Score = 49.7 bits (117), Expect(2) = 2e-19 Identities = 21/32 (65%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +2 Query: 2 FIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 94 F+DT PFVDKYF K + +K++W+GVLPR KYL Sbjct: 128 FVDTTPFVDKYFLKPKDHKYDWRGVLPRKKYL 159 >gb|AAF60317.1|AF236109_1 putative purple acid phosphatase precursor [Phaseolus vulgaris] Length = 331 Score = 69.7 bits (169), Expect(2) = 6e-18 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = +3 Query: 207 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSN 341 DL ALK S A WKIVVGHHP+RSIG GDT EL++H+LPIL +N Sbjct: 189 DLEIALKDSTAKWKIVVGHHPVRSIGHHGDTQELIRHLLPILEAN 233 Score = 45.8 bits (107), Expect(2) = 6e-18 Identities = 20/32 (62%), Positives = 25/32 (78%), Gaps = 1/32 (3%) Frame = +2 Query: 2 FIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 94 F+DT PFVDKYF K + + ++W GVLPR KYL Sbjct: 152 FVDTTPFVDKYFLKPKDHTYDWTGVLPRDKYL 183 >ref|NP_001241371.1| uncharacterized protein LOC100817359 precursor [Glycine max] gi|255640157|gb|ACU20369.1| unknown [Glycine max] Length = 329 Score = 66.6 bits (161), Expect(2) = 8e-18 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 207 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSNH 344 DL ALK S A WKIVVGHHP+RSIG GDT EL++ +LPIL N+ Sbjct: 191 DLEIALKDSTAKWKIVVGHHPVRSIGHHGDTKELIRQLLPILEENN 236 Score = 48.5 bits (114), Expect(2) = 8e-18 Identities = 21/32 (65%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +2 Query: 2 FIDTNPFVDKYFFK-QPNKFNWKGVLPRYKYL 94 FID+ PFVDKYF K + +K++W+GVLPR KYL Sbjct: 154 FIDSTPFVDKYFLKPKDHKYDWRGVLPREKYL 185 >emb|CAE85073.1| putative acid phosphatase [Lupinus luteus] Length = 330 Score = 64.3 bits (155), Expect(2) = 9e-16 Identities = 29/45 (64%), Positives = 33/45 (73%) Frame = +3 Query: 207 DLNTALKRSNATWKIVVGHHPIRSIGRRGDTVELLKHILPILTSN 341 DL A+K S A WKIVVGHH IRS+G GDT EL+K +LPIL N Sbjct: 195 DLELAIKESTAQWKIVVGHHAIRSVGHHGDTQELIKQLLPILQEN 239 Score = 43.9 bits (102), Expect(2) = 9e-16 Identities = 14/31 (45%), Positives = 25/31 (80%) Frame = +2 Query: 2 FIDTNPFVDKYFFKQPNKFNWKGVLPRYKYL 94 F+DT PFV+KYF + +K++W+G++P+ Y+ Sbjct: 159 FVDTTPFVEKYFTETKHKYDWQGIIPQKSYI 189