BLASTX nr result
ID: Scutellaria23_contig00035482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035482 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511509.1| nitrate transporter, putative [Ricinus commu... 58 7e-07 gb|ADH21397.1| nitrate transporter [Citrus trifoliata] 55 4e-06 ref|XP_002270812.1| PREDICTED: probable peptide/nitrate transpor... 55 6e-06 ref|XP_002300021.1| predicted protein [Populus trichocarpa] gi|2... 55 8e-06 ref|NP_001237970.1| nitrate transporter NRT1-2 [Glycine max] gi|... 54 1e-05 >ref|XP_002511509.1| nitrate transporter, putative [Ricinus communis] gi|223550624|gb|EEF52111.1| nitrate transporter, putative [Ricinus communis] Length = 602 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = -1 Query: 249 DYFYYLIIALCTINFCFFLVCANWYRYKGTEDSTISIEIEVKKLEHHSA 103 DY+YYLI AL +NF +FL+CA WY+YKG TI + E K E H A Sbjct: 554 DYYYYLIAALGVLNFGYFLICAKWYKYKGGNAVTIEMTREKKPSEKHVA 602 >gb|ADH21397.1| nitrate transporter [Citrus trifoliata] Length = 588 Score = 55.5 bits (132), Expect = 4e-06 Identities = 22/40 (55%), Positives = 29/40 (72%) Frame = -1 Query: 249 DYFYYLIIALCTINFCFFLVCANWYRYKGTEDSTISIEIE 130 DYFYYL+ AL +NF FFL+CA WY+YKG+ D + +E Sbjct: 540 DYFYYLVAALGLLNFGFFLLCAKWYKYKGSGDGAPEVAME 579 >ref|XP_002270812.1| PREDICTED: probable peptide/nitrate transporter At5g62680 [Vitis vinifera] Length = 586 Score = 55.1 bits (131), Expect = 6e-06 Identities = 20/40 (50%), Positives = 29/40 (72%) Frame = -1 Query: 249 DYFYYLIIALCTINFCFFLVCANWYRYKGTEDSTISIEIE 130 DYFYYL+ AL +N +FL CA WY+YK +E+S + + +E Sbjct: 538 DYFYYLVAALGMVNLLYFLACAKWYKYKDSEESPLEVSLE 577 >ref|XP_002300021.1| predicted protein [Populus trichocarpa] gi|222847279|gb|EEE84826.1| predicted protein [Populus trichocarpa] Length = 596 Score = 54.7 bits (130), Expect = 8e-06 Identities = 21/37 (56%), Positives = 28/37 (75%) Frame = -1 Query: 249 DYFYYLIIALCTINFCFFLVCANWYRYKGTEDSTISI 139 DYFYY+I L +NF +FL+CA WYRYK +DST+ + Sbjct: 555 DYFYYVIAGLGILNFGYFLLCAKWYRYKDADDSTVGM 591 >ref|NP_001237970.1| nitrate transporter NRT1-2 [Glycine max] gi|11933400|dbj|BAB19757.1| nitrate transporter NRT1-2 [Glycine max] Length = 605 Score = 54.3 bits (129), Expect = 1e-05 Identities = 20/34 (58%), Positives = 27/34 (79%) Frame = -1 Query: 249 DYFYYLIIALCTINFCFFLVCANWYRYKGTEDST 148 DYFYY+I AL +NF +F++CA WY+YKGT S+ Sbjct: 552 DYFYYIITALAVVNFGYFILCAKWYKYKGTGSSS 585