BLASTX nr result
ID: Scutellaria23_contig00035468
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035468 (337 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAG51231.1|AC035249_6 unknown protein; 65731-67017 [Arabidops... 57 2e-06 >gb|AAG51231.1|AC035249_6 unknown protein; 65731-67017 [Arabidopsis thaliana] Length = 333 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/39 (66%), Positives = 30/39 (76%) Frame = -2 Query: 117 EIGEERLMNDYFIDRPTYAPEIFRRRFRMQKSLLLRIVE 1 E G +L+NDYF + PTY P IFRRRFRM KSL +RIVE Sbjct: 49 EEGHIQLVNDYFTENPTYPPHIFRRRFRMNKSLFMRIVE 87