BLASTX nr result
ID: Scutellaria23_contig00035417
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035417 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_173848.2| uncharacterized protein [Arabidopsis thaliana] ... 58 7e-07 gb|ABK28413.1| unknown [Arabidopsis thaliana] 58 7e-07 >ref|NP_173848.2| uncharacterized protein [Arabidopsis thaliana] gi|9743328|gb|AAF97952.1|AC000103_2 F21J9.4 [Arabidopsis thaliana] gi|91805847|gb|ABE65652.1| hypothetical protein At1g24380 [Arabidopsis thaliana] gi|332192402|gb|AEE30523.1| uncharacterized protein [Arabidopsis thaliana] Length = 293 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = +3 Query: 60 RIQERNLRSLQSRFQTIYQAVSKLKECLGQIQCTNRSGFSELDLLNRAKQIMRQDPKY 233 +IQ R RSLQ+R +I AVSKL+ C+ QI+ N SG SE D+LN+AK ++ Q KY Sbjct: 8 KIQRRPKRSLQTRMTSILSAVSKLRGCVNQIENKNPSGASEEDILNQAKMLLTQYEKY 65 >gb|ABK28413.1| unknown [Arabidopsis thaliana] Length = 294 Score = 58.2 bits (139), Expect = 7e-07 Identities = 30/58 (51%), Positives = 40/58 (68%) Frame = +3 Query: 60 RIQERNLRSLQSRFQTIYQAVSKLKECLGQIQCTNRSGFSELDLLNRAKQIMRQDPKY 233 +IQ R RSLQ+R +I AVSKL+ C+ QI+ N SG SE D+LN+AK ++ Q KY Sbjct: 8 KIQRRPKRSLQTRMTSILSAVSKLRGCVNQIENKNPSGASEEDILNQAKMLLTQYEKY 65