BLASTX nr result
ID: Scutellaria23_contig00035016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00035016 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|2... 79 5e-13 ref|XP_002530545.1| protein binding protein, putative [Ricinus c... 78 8e-13 dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] 77 2e-12 ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261... 75 5e-12 emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] 75 5e-12 >ref|XP_002317723.1| predicted protein [Populus trichocarpa] gi|222858396|gb|EEE95943.1| predicted protein [Populus trichocarpa] Length = 326 Score = 78.6 bits (192), Expect = 5e-13 Identities = 34/54 (62%), Positives = 38/54 (70%) Frame = +2 Query: 2 LSLATAHHRHELALSFESPYGDKSFCCDICKAQGSNQWLYRCSLCDFDAHLKCA 163 LSLA H H+L L+F PY K F CDIC GSN WLYRCS C+FDAH+KCA Sbjct: 119 LSLAHQSHPHQLNLAFYPPYQTKGFSCDICHKIGSNHWLYRCSACEFDAHMKCA 172 >ref|XP_002530545.1| protein binding protein, putative [Ricinus communis] gi|223529907|gb|EEF31836.1| protein binding protein, putative [Ricinus communis] Length = 324 Score = 77.8 bits (190), Expect = 8e-13 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = +2 Query: 2 LSLATAHHRHELALSFESPYGDKSFCCDICKAQGSNQWLYRCSLCDFDAHLKCARG 169 LSL H H L L+F+ PY K F CDIC+ GSN WLYRC+ C+FDAHL+CA G Sbjct: 120 LSLTNQFHPHLLQLTFDPPYHTKGFSCDICQKIGSNHWLYRCAPCEFDAHLECAMG 175 >dbj|BAF80453.1| DC1 domain containing protein [Nicotiana tabacum] Length = 212 Score = 76.6 bits (187), Expect = 2e-12 Identities = 30/46 (65%), Positives = 32/46 (69%) Frame = +2 Query: 23 HRHELALSFESPYGDKSFCCDICKAQGSNQWLYRCSLCDFDAHLKC 160 H H+L L F PY KSFCCDICK G+N WLYRC C FDAHL C Sbjct: 134 HHHQLDLKFSPPYPGKSFCCDICKKVGTNHWLYRCQTCGFDAHLNC 179 >ref|XP_002268131.1| PREDICTED: uncharacterized protein LOC100261320 [Vitis vinifera] Length = 360 Score = 75.1 bits (183), Expect = 5e-12 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +2 Query: 23 HRHELALSFESPYGDKSFCCDICKAQGSNQWLYRCSLCDFDAHLKCA 163 H H LALSF PY +KSF CDIC+ G++ WLYRC C+FDAHL CA Sbjct: 131 HHHRLALSFSPPYHNKSFSCDICRQIGTSHWLYRCDECEFDAHLSCA 177 >emb|CAN66246.1| hypothetical protein VITISV_033016 [Vitis vinifera] Length = 366 Score = 75.1 bits (183), Expect = 5e-12 Identities = 30/47 (63%), Positives = 35/47 (74%) Frame = +2 Query: 23 HRHELALSFESPYGDKSFCCDICKAQGSNQWLYRCSLCDFDAHLKCA 163 H H LALSF PY +KSF CDIC+ G++ WLYRC C+FDAHL CA Sbjct: 137 HHHRLALSFSPPYHNKSFSCDICRQIGTSHWLYRCDECEFDAHLSCA 183