BLASTX nr result
ID: Scutellaria23_contig00034916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034916 (377 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002522625.1| conserved hypothetical protein [Ricinus comm... 59 3e-07 >ref|XP_002522625.1| conserved hypothetical protein [Ricinus communis] gi|223538101|gb|EEF39712.1| conserved hypothetical protein [Ricinus communis] Length = 368 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/66 (48%), Positives = 46/66 (69%), Gaps = 3/66 (4%) Frame = -2 Query: 316 GIGFNSGAMLIIRLPDSRALRIMSRSLFIAMVLLALPSIFSLMR---ASSGAPLNNAVSV 146 GI NS +L+I++PDSR LRI+SRS+F+A+V+L LP I S++R +SS P++ SV Sbjct: 8 GIALNSTTLLVIKIPDSRVLRIVSRSVFLAVVILTLPCIGSILRELSSSSYYPVSGDDSV 67 Query: 145 PDASSD 128 D D Sbjct: 68 SDLIDD 73