BLASTX nr result
ID: Scutellaria23_contig00034882
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034882 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280392.2| PREDICTED: probable flavin-containing monoox... 102 4e-25 ref|XP_002277560.1| PREDICTED: probable flavin-containing monoox... 99 5e-24 emb|CBI27765.3| unnamed protein product [Vitis vinifera] 99 5e-24 ref|XP_003541317.1| PREDICTED: probable flavin-containing monoox... 98 1e-23 ref|XP_002893036.1| flavin-dependent monooxygenase 1 [Arabidopsi... 97 3e-23 >ref|XP_002280392.2| PREDICTED: probable flavin-containing monooxygenase 1-like [Vitis vinifera] gi|296081743|emb|CBI20748.3| unnamed protein product [Vitis vinifera] Length = 523 Score = 102 bits (255), Expect(2) = 4e-25 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = +1 Query: 1 GQACTMVVRTLHWTVPHYSVWGLPFYMFYSTRASQFLHERPNQSFVRSLLCHTLLSPM 174 GQ CTMV+RTLHWTVP Y +WGLPF++FYSTR SQFLHERPNQSF+R+LLC LLSPM Sbjct: 239 GQPCTMVIRTLHWTVPSYWIWGLPFFLFYSTRFSQFLHERPNQSFLRTLLCF-LLSPM 295 Score = 37.0 bits (84), Expect(2) = 4e-25 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 267 RKAVSKIIESYLTWKLPLEK 326 RKA+SK IESYL WKLPL K Sbjct: 296 RKAISKFIESYLVWKLPLVK 315 >ref|XP_002277560.1| PREDICTED: probable flavin-containing monooxygenase 1 [Vitis vinifera] Length = 522 Score = 99.4 bits (246), Expect(2) = 5e-24 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +1 Query: 1 GQACTMVVRTLHWTVPHYSVWGLPFYMFYSTRASQFLHERPNQSFVRSLLCHTLLSPM 174 GQ CTMV+RTLHWTVPHY VWGLPF FYSTR SQF HERP+Q +RSL CH LLSPM Sbjct: 236 GQPCTMVIRTLHWTVPHYWVWGLPFSWFYSTRFSQFFHERPDQGMLRSLFCH-LLSPM 292 Score = 36.6 bits (83), Expect(2) = 5e-24 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 267 RKAVSKIIESYLTWKLPLEK 326 R+AVSK IESYL WKLPL K Sbjct: 293 RQAVSKFIESYLAWKLPLRK 312 >emb|CBI27765.3| unnamed protein product [Vitis vinifera] Length = 456 Score = 99.4 bits (246), Expect(2) = 5e-24 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +1 Query: 1 GQACTMVVRTLHWTVPHYSVWGLPFYMFYSTRASQFLHERPNQSFVRSLLCHTLLSPM 174 GQ CTMV+RTLHWTVPHY VWGLPF FYSTR SQF HERP+Q +RSL CH LLSPM Sbjct: 170 GQPCTMVIRTLHWTVPHYWVWGLPFSWFYSTRFSQFFHERPDQGMLRSLFCH-LLSPM 226 Score = 36.6 bits (83), Expect(2) = 5e-24 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 267 RKAVSKIIESYLTWKLPLEK 326 R+AVSK IESYL WKLPL K Sbjct: 227 RQAVSKFIESYLAWKLPLRK 246 >ref|XP_003541317.1| PREDICTED: probable flavin-containing monooxygenase 1-like [Glycine max] Length = 517 Score = 97.8 bits (242), Expect(2) = 1e-23 Identities = 41/58 (70%), Positives = 51/58 (87%) Frame = +1 Query: 1 GQACTMVVRTLHWTVPHYSVWGLPFYMFYSTRASQFLHERPNQSFVRSLLCHTLLSPM 174 GQ CTMVVRTLHWTVPHY +WGLPF++F+STR+SQF+HERPNQ +R+LLC + SP+ Sbjct: 231 GQPCTMVVRTLHWTVPHYWIWGLPFFLFFSTRSSQFIHERPNQGLLRTLLC-LMCSPL 287 Score = 36.6 bits (83), Expect(2) = 1e-23 Identities = 15/20 (75%), Positives = 17/20 (85%) Frame = +3 Query: 267 RKAVSKIIESYLTWKLPLEK 326 R+ +SK IESYL WKLPLEK Sbjct: 288 RRGISKFIESYLLWKLPLEK 307 >ref|XP_002893036.1| flavin-dependent monooxygenase 1 [Arabidopsis lyrata subsp. lyrata] gi|297338878|gb|EFH69295.1| flavin-dependent monooxygenase 1 [Arabidopsis lyrata subsp. lyrata] Length = 530 Score = 97.1 bits (240), Expect(2) = 3e-23 Identities = 40/51 (78%), Positives = 46/51 (90%) Frame = +1 Query: 1 GQACTMVVRTLHWTVPHYSVWGLPFYMFYSTRASQFLHERPNQSFVRSLLC 153 G+ACTMVVRT HW PHY VWGLPF++FYSTRASQFLH+RPNQSF+R+L C Sbjct: 235 GKACTMVVRTTHWVFPHYWVWGLPFFLFYSTRASQFLHDRPNQSFLRTLFC 285 Score = 36.2 bits (82), Expect(2) = 3e-23 Identities = 16/20 (80%), Positives = 17/20 (85%) Frame = +3 Query: 267 RKAVSKIIESYLTWKLPLEK 326 R AVSK IESY+ WKLPLEK Sbjct: 292 RAAVSKFIESYVLWKLPLEK 311