BLASTX nr result
ID: Scutellaria23_contig00034779
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034779 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005041088.1| hypothetical protein AZOLI_p50001 [Azospiril... 70 3e-13 emb|CAJ30047.1| conserved hypothetical protein [Magnetospirillum... 78 7e-13 ref|YP_005415571.1| hypothetical protein RSPPHO_03262, partial [... 74 2e-11 ref|ZP_02955128.1| conserved hypothetical protein [Clostridium b... 72 6e-11 ref|ZP_02955142.1| conserved hypothetical protein [Clostridium b... 72 6e-11 >ref|YP_005041088.1| hypothetical protein AZOLI_p50001 [Azospirillum lipoferum 4B] gi|357428061|emb|CBS91011.1| conserved protein of unknown function [Azospirillum lipoferum 4B] Length = 113 Score = 70.1 bits (170), Expect(2) = 3e-13 Identities = 38/56 (67%), Positives = 39/56 (69%) Frame = +3 Query: 3 YAIILDERFPTVLSLPSHASVTL*EATAPVKLPTMRCPGPR*GDAVRYP*PLGWYF 170 YAI LDERFPT LS PS ASVTL EATAPVKLP M+ PGP VR GWYF Sbjct: 29 YAIALDERFPTALSPPSRASVTLWEATAPVKLPAMQGPGPGSRATVRCQRLQGWYF 84 Score = 29.6 bits (65), Expect(2) = 3e-13 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = +1 Query: 178 GSTMAGATASKPTTYSTQTV 237 GST AGA ASKP TY T V Sbjct: 87 GSTRAGAQASKPPTYPTHEV 106 >emb|CAJ30047.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense MSR-1] Length = 149 Score = 78.2 bits (191), Expect = 7e-13 Identities = 44/79 (55%), Positives = 49/79 (62%) Frame = +2 Query: 2 LCHYTRRTISDRSEPTFARLRYSLGGDRPSQTAHHALSRSPLRGRG*ISITIRVVFHISA 181 LCH TR+ ISD+ E T ARLRYSLGGDRPSQT HHA SR+ G + + A Sbjct: 55 LCHCTRQLISDQLELTIARLRYSLGGDRPSQTTHHAGSRARFHGSRLDTRKQKGGISRMA 114 Query: 182 PPWLAPRLQSLPPILHKQS 238 P LAP SLPPILH S Sbjct: 115 PHQLAPMFHSLPPILHIHS 133 >ref|YP_005415571.1| hypothetical protein RSPPHO_03262, partial [Rhodospirillum photometricum DSM 122] gi|378401485|emb|CCG06601.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum DSM 122] Length = 104 Score = 73.6 bits (179), Expect = 2e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = +2 Query: 5 CHYTRRTISDRSEPTFARLRYSLGGDRPSQTAHHALSRSPLRGRG 139 CH TR+ ISDR EPT ARLRYSLGGDRPSQT HHA SR+ + GRG Sbjct: 60 CHCTRQPISDRPEPTIARLRYSLGGDRPSQTTHHAGSRTRITGRG 104 >ref|ZP_02955128.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] gi|226947650|ref|YP_002802741.1| hypothetical protein CLM_0490 [Clostridium botulinum A2 str. Kyoto] gi|226950969|ref|YP_002806060.1| hypothetical protein CLM_3990 [Clostridium botulinum A2 str. Kyoto] gi|226950971|ref|YP_002806062.1| hypothetical protein CLM_3999 [Clostridium botulinum A2 str. Kyoto] gi|182668006|gb|EDT79985.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] gi|226841315|gb|ACO83981.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226842887|gb|ACO85553.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] gi|226844092|gb|ACO86758.1| conserved hypothetical protein [Clostridium botulinum A2 str. Kyoto] Length = 218 Score = 71.6 bits (174), Expect = 6e-11 Identities = 40/77 (51%), Positives = 47/77 (61%) Frame = +2 Query: 5 CHYTRRTISDRSEPTFARLRYSLGGDRPSQTAHHALSRSPLRGRG*ISITIRVVFHISAP 184 C T R ISDR+E TF RLRY LGGDRPSQTAH +SR + GR + P Sbjct: 63 CLCTLRAISDRAEGTFGRLRYFLGGDRPSQTAHLTMSRDQIHGRRLEPQYCQGGIPRMTP 122 Query: 185 PWLAPRLQSLPPILHKQ 235 L P+L SLPPIL++Q Sbjct: 123 LRLTPKLPSLPPILYRQ 139 >ref|ZP_02955142.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] gi|182667948|gb|EDT79927.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916] Length = 166 Score = 71.6 bits (174), Expect = 6e-11 Identities = 40/77 (51%), Positives = 47/77 (61%) Frame = +2 Query: 5 CHYTRRTISDRSEPTFARLRYSLGGDRPSQTAHHALSRSPLRGRG*ISITIRVVFHISAP 184 C T R ISDR+E TF RLRY LGGDRPSQTAH +SR + GR + P Sbjct: 32 CLCTLRAISDRAEGTFGRLRYFLGGDRPSQTAHLTMSRDQIHGRRLEPQYCQGGIPRMTP 91 Query: 185 PWLAPRLQSLPPILHKQ 235 L P+L SLPPIL++Q Sbjct: 92 LRLTPKLPSLPPILYRQ 108