BLASTX nr result
ID: Scutellaria23_contig00034749
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034749 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521029.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] 58 7e-07 >ref|XP_002521029.1| conserved hypothetical protein [Ricinus communis] gi|223539866|gb|EEF41446.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 59.7 bits (143), Expect = 2e-07 Identities = 26/50 (52%), Positives = 39/50 (78%) Frame = +2 Query: 113 TAVRIKVKKLQKIVPGGEGMSPHTLLLRTADYILLLTMQINVLHYLYNLH 262 T+++++VKKLQ+++PGGE + P L LRTADYIL L +Q+NVL L ++ Sbjct: 37 TSIQMRVKKLQRLIPGGEELQPDRLFLRTADYILHLELQVNVLQALSEIY 86 >emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] Length = 77 Score = 58.2 bits (139), Expect = 7e-07 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = +2 Query: 107 KKTAVRIKVKKLQKIVPGGEGMSPHTLLLRTADYILLLTMQINVLHY 247 ++ +VR KVKKLQ+++PGG G+ P L LRTADYIL L +Q+ +L Y Sbjct: 18 RRRSVRRKVKKLQRLIPGGRGLQPDRLFLRTADYILHLRLQMGILLY 64