BLASTX nr result
ID: Scutellaria23_contig00034727
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034727 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [V... 93 2e-17 ref|XP_002509935.1| amino acid transporter, putative [Ricinus co... 92 3e-17 gb|AAM63237.1| amino acid permease-like protein [Arabidopsis tha... 92 6e-17 ref|NP_568597.1| Transmembrane amino acid transporter family pro... 92 6e-17 dbj|BAB10655.1| amino acid permease-like protein; proline transp... 92 6e-17 >ref|XP_002273161.1| PREDICTED: lysine histidine transporter 1 [Vitis vinifera] gi|297742313|emb|CBI34462.3| unnamed protein product [Vitis vinifera] Length = 455 Score = 93.2 bits (230), Expect = 2e-17 Identities = 47/55 (85%), Positives = 48/55 (87%) Frame = -3 Query: 337 PMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 173 PMLLYNMTHKP RSS+ YWIN SIIIVFT GIMGAFSSIRKL LDA KFKLFSS Sbjct: 397 PMLLYNMTHKPPRSSLMYWINISIIIVFTDAGIMGAFSSIRKLILDAYKFKLFSS 451 >ref|XP_002509935.1| amino acid transporter, putative [Ricinus communis] gi|223549834|gb|EEF51322.1| amino acid transporter, putative [Ricinus communis] Length = 452 Score = 92.4 bits (228), Expect = 3e-17 Identities = 45/55 (81%), Positives = 49/55 (89%) Frame = -3 Query: 337 PMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 173 PMLLYNMT+KP RSS+ YWIN SII+VFT GIMGAFSSIRKL LDA+KFKLFSS Sbjct: 394 PMLLYNMTYKPRRSSLTYWINISIIVVFTGAGIMGAFSSIRKLVLDAKKFKLFSS 448 >gb|AAM63237.1| amino acid permease-like protein [Arabidopsis thaliana] Length = 452 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 337 PMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 173 PMLLYNMT+KP R S YWIN +I++VFTC G+MGAFSSIRKL LDA KFKLFSS Sbjct: 394 PMLLYNMTYKPTRRSFTYWINMTIMVVFTCAGLMGAFSSIRKLVLDANKFKLFSS 448 >ref|NP_568597.1| Transmembrane amino acid transporter family protein [Arabidopsis thaliana] gi|75245603|sp|Q8L4X4.1|GAT2_ARATH RecName: Full=Probable GABA transporter 2 gi|20466438|gb|AAM20536.1| amino acid permease-like protein [Arabidopsis thaliana] gi|22136372|gb|AAM91264.1| amino acid permease-like protein [Arabidopsis thaliana] gi|332007347|gb|AED94730.1| Transmembrane amino acid transporter family protein [Arabidopsis thaliana] Length = 452 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 337 PMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 173 PMLLYNMT+KP R S YWIN +I++VFTC G+MGAFSSIRKL LDA KFKLFSS Sbjct: 394 PMLLYNMTYKPTRRSFTYWINMTIMVVFTCAGLMGAFSSIRKLVLDANKFKLFSS 448 >dbj|BAB10655.1| amino acid permease-like protein; proline transporter-like protein [Arabidopsis thaliana] Length = 423 Score = 91.7 bits (226), Expect = 6e-17 Identities = 42/55 (76%), Positives = 47/55 (85%) Frame = -3 Query: 337 PMLLYNMTHKPARSSVAYWINNSIIIVFTCVGIMGAFSSIRKLALDAEKFKLFSS 173 PMLLYNMT+KP R S YWIN +I++VFTC G+MGAFSSIRKL LDA KFKLFSS Sbjct: 365 PMLLYNMTYKPTRRSFTYWINMTIMVVFTCAGLMGAFSSIRKLVLDANKFKLFSS 419