BLASTX nr result
ID: Scutellaria23_contig00034374
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Scutellaria23_contig00034374 (272 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina... 168 5e-40 gb|AEK71432.1| ribosomal protein L23 [Carica papaya] 166 2e-39 ref|YP_817525.1| ribosomal protein L23 [Coffea arabica] gi|11661... 166 2e-39 ref|YP_007353957.1| ribosomal protein L23 (chloroplast) [Tectona... 163 1e-38 ref|YP_004940551.1| rpl23 gene product (chloroplast) [Boea hygro... 163 1e-38 >ref|YP_005296142.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|377829934|ref|YP_005296161.1| rpl23 gene product (chloroplast) [Pentactina rupicola] gi|340806942|gb|AEK71570.1| ribosomal protein L23 [Spiraea tomentosa] gi|371532663|gb|AEX31773.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] gi|371532682|gb|AEX31792.1| ribosomal protein L23 (chloroplast) [Pentactina rupicola] Length = 93 Score = 168 bits (425), Expect = 5e-40 Identities = 79/81 (97%), Positives = 81/81 (100%) Frame = -1 Query: 272 SIRLLGKNQYTFNVESGLTRTELKHWVELFFGVRVIAMNSHRLPGKGRRMGPIMGHTMHY 93 SIRLLGKNQYTFNVESGLTRTE+KHWVELFFGV+VIAMNSHRLPGKGRRMGPIMGHTMHY Sbjct: 13 SIRLLGKNQYTFNVESGLTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHY 72 Query: 92 RRMIITLQPGYSIPPLRKKRT 30 RRMIITLQPGYSIPPLRKKRT Sbjct: 73 RRMIITLQPGYSIPPLRKKRT 93 >gb|AEK71432.1| ribosomal protein L23 [Carica papaya] Length = 93 Score = 166 bits (419), Expect = 2e-39 Identities = 78/81 (96%), Positives = 80/81 (98%) Frame = -1 Query: 272 SIRLLGKNQYTFNVESGLTRTELKHWVELFFGVRVIAMNSHRLPGKGRRMGPIMGHTMHY 93 SIRLLGKNQYTFNVESGLTRTE+KHWVELFFGV+VIAMNSHRLPGK RRMGPIMGHTMHY Sbjct: 13 SIRLLGKNQYTFNVESGLTRTEIKHWVELFFGVKVIAMNSHRLPGKSRRMGPIMGHTMHY 72 Query: 92 RRMIITLQPGYSIPPLRKKRT 30 RRMIITLQPGYSIPPLRKKRT Sbjct: 73 RRMIITLQPGYSIPPLRKKRT 93 >ref|YP_817525.1| ribosomal protein L23 [Coffea arabica] gi|116617171|ref|YP_817544.1| ribosomal protein L23 [Coffea arabica] gi|122153662|sp|A0A378.1|RK23_COFAR RecName: Full=50S ribosomal protein L23, chloroplastic gi|116242206|gb|ABJ89721.1| ribosomal protein L23 [Coffea arabica] gi|116242227|gb|ABJ89742.1| ribosomal protein L23 [Coffea arabica] gi|340806845|gb|AEK71486.1| ribosomal protein L23 [Ixerba brexioides] gi|340806881|gb|AEK71517.1| ribosomal protein L23 [Melianthus comosus] Length = 93 Score = 166 bits (419), Expect = 2e-39 Identities = 78/81 (96%), Positives = 80/81 (98%) Frame = -1 Query: 272 SIRLLGKNQYTFNVESGLTRTELKHWVELFFGVRVIAMNSHRLPGKGRRMGPIMGHTMHY 93 SIRLLGKNQYTFNVESG TRTE+KHWVELFFGV+VIAMNSHRLPGKGRRMGPIMGHTMHY Sbjct: 13 SIRLLGKNQYTFNVESGSTRTEIKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHY 72 Query: 92 RRMIITLQPGYSIPPLRKKRT 30 RRMIITLQPGYSIPPLRKKRT Sbjct: 73 RRMIITLQPGYSIPPLRKKRT 93 >ref|YP_007353957.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|442743026|ref|YP_007353978.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438687646|emb|CCP47173.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438687667|emb|CCP47197.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688330|emb|CCP47262.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688351|emb|CCP47286.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688454|emb|CCP47351.1| ribosomal protein L23 (chloroplast) [Tectona grandis] gi|438688475|emb|CCP47375.1| ribosomal protein L23 (chloroplast) [Tectona grandis] Length = 93 Score = 163 bits (413), Expect = 1e-38 Identities = 78/81 (96%), Positives = 79/81 (97%) Frame = -1 Query: 272 SIRLLGKNQYTFNVESGLTRTELKHWVELFFGVRVIAMNSHRLPGKGRRMGPIMGHTMHY 93 SIRLLGKNQYT NVESG TRTELKHWVELFFGV+VIAMNSHRLPGKGRRMGPIMGHTMHY Sbjct: 13 SIRLLGKNQYTSNVESGSTRTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHY 72 Query: 92 RRMIITLQPGYSIPPLRKKRT 30 RRMIITLQPGYSIPPLRKKRT Sbjct: 73 RRMIITLQPGYSIPPLRKKRT 93 >ref|YP_004940551.1| rpl23 gene product (chloroplast) [Boea hygrometrica] gi|364284048|ref|YP_004940573.1| rpl23 gene product (chloroplast) [Boea hygrometrica] gi|459014536|ref|YP_007507154.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|459014557|ref|YP_007507175.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|290487722|gb|ADD30245.1| ribosomal protein L23 [Antirrhinum majus] gi|340549449|gb|AEK53271.1| ribosomal protein L23 (chloroplast) [Boea hygrometrica] gi|340549471|gb|AEK53293.1| ribosomal protein L23 (chloroplast) [Boea hygrometrica] gi|340807054|gb|AEK71662.1| ribosomal protein L23 [Antirrhinum majus] gi|401879784|gb|AFQ30971.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] gi|401879807|gb|AFQ30994.1| ribosomal protein L23 (chloroplast) [Salvia miltiorrhiza] Length = 93 Score = 163 bits (413), Expect = 1e-38 Identities = 78/81 (96%), Positives = 79/81 (97%) Frame = -1 Query: 272 SIRLLGKNQYTFNVESGLTRTELKHWVELFFGVRVIAMNSHRLPGKGRRMGPIMGHTMHY 93 SIRLLGKNQYT NVESG TRTELKHWVELFFGV+VIAMNSHRLPGKGRRMGPIMGHTMHY Sbjct: 13 SIRLLGKNQYTSNVESGSTRTELKHWVELFFGVKVIAMNSHRLPGKGRRMGPIMGHTMHY 72 Query: 92 RRMIITLQPGYSIPPLRKKRT 30 RRMIITLQPGYSIPPLRKKRT Sbjct: 73 RRMIITLQPGYSIPPLRKKRT 93